SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000013757 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000013757
Domain Number 1 Region: 34-223
Classification Level Classification E-value
Superfamily eIF4e-like 3.4e-57
Family Translation initiation factor eIF4e 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000013757   Gene: ENSORLG00000010970   Transcript: ENSORLT00000013758
Sequence length 227
Comment pep:known chromosome:MEDAKA1:5:21036483:21044613:-1 gene:ENSORLG00000010970 transcript:ENSORLT00000013758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPAGQTGLQPNRGAPSGHSVPCENNIDIDEKELENITKKHREDDATALPLHSPWTFWL
DRSLPGTTAAECESNLKKIYTVQTVQTFWSVYNNIPPVTALPLRCSYHLMRGERRPLWEE
ESNARGGVWKMKIPKESSAAVWKELLLATIGEQFADYCAIDDEVVGVSVSVRDREDVVQI
WNSEASLANEANILGKVYELLPSISFKAVFYKSHMEHHAFEGGRSRH
Download sequence
Identical sequences H2M5M5
ENSORLP00000013757 ENSORLP00000013757 XP_004068975.1.28442 8090.ENSORLP00000013757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]