SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000013824 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000013824
Domain Number 1 Region: 1649-1742,1781-1830
Classification Level Classification E-value
Superfamily RNase III domain-like 2.27e-41
Family RNase III catalytic domain-like 0.00078
Further Details:      
 
Domain Number 2 Region: 1265-1342,1542-1582
Classification Level Classification E-value
Superfamily RNase III domain-like 9.03e-30
Family RNase III catalytic domain-like 0.0088
Further Details:      
 
Domain Number 3 Region: 48-203,426-544
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.78e-28
Family Tandem AAA-ATPase domain 0.0068
Further Details:      
 
Domain Number 4 Region: 919-979
Classification Level Classification E-value
Superfamily PAZ domain 0.00000000628
Family PAZ domain 0.009
Further Details:      
 
Domain Number 5 Region: 1789-1901
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000038
Family Double-stranded RNA-binding domain (dsRBD) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000013824   Gene: ENSORLG00000011022   Transcript: ENSORLT00000013825
Sequence length 1905
Comment pep:novel chromosome:MEDAKA1:22:3615697:3632581:-1 gene:ENSORLG00000011022 transcript:ENSORLT00000013825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMAGLQLITPATSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALEHNTIVCLNTGSG
KTFIAVLLTKELSHQIRGSYQENARRTVFLANATSSAVQQAAAVRTHSDLHVGEYSDPQE
ATTWSRQRWSREIADNQVLVMTCHVFLHVLTNHILPLSKINLVVFDDCHLAITEHPYCEV
MKLFEEHTCGSRILGLTASILNGKCDPSELEQKIQNLERILKSSAETATDLVVLDRYACQ
PREVVLDCGPYMDKSGLSSRLQAELEEALLFLNDCNISASREDRDPTFISKQILSDCLAV
LQVLGPWCADKAAGIMVRELQKYIKHEQEELSRKFLLFTDTILRKVHALCEEHFSPASLD
LKFVTPKVLRLLEILHEYKPFERQQFESVEWYNNRNQDNYVSWSDSEDEDEDEEVEAKER
PETNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFITGHSIGKNQA
RNKQMEVEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLPTEYRSYVQS
KGRARAPVSNYIMLADSERTQAFQEDLTTYKAIEKILRNKCSKSVEVGEFDGEQVVDDDN
ILPPYVLRSEDGGPRVTVNTAIGHINRYCARLPSDPFTHLAPKCKTVETGNGRFQSTLYL
PINSPLRVPIKGPTMHCARLAEKAVALLCCEKLHKIGELDDHLMPVGKETVKYEEELDLH
DEEETSVPGRPGSTKRRQCYPKAIPECLRDSYAVPEQTYYLYVIGMVLTTPLPDELNFRR
RKLYPPEDTTRTFGILTAKPIPRIPHFPVYTRSGEVTISIELQKSGFTLSAAQLDLITRL
HQYIFSHILRLEKPALEFKPTVADSAYCVLPLNVVGDSNTLDMDFKFMEDIEKSEARTGI
PTTKYTKQNPFTFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTYLTPLSKFPSPEYETFA
EYYKTKYNLDLSNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKRKAKWESLQN
KQILVPELCAIHPIPASLWRKAVCLPSILYRLHCLLTAEELRAQTACEAGVGIQTLPPDF
RYPNLDFGWKRSIDNKAYSSCSESCSEDGVCVHQEAGSSEPALSAHPSRSLSPQPEPHLA
PAPKNGSCVLNLTNGTAESGPQDEHLHQPDSCQCQLSSSSSGLQSAESEQVSTSAPARAP
SSSISPQPSSECMPARTSHHTPETTSGCELSATAPRSPTAPSSDSTNEHQQGSTVGDSPK
NLGPNPGLILQALTLSNASDGFNLERLEMLGDSFLKHAITTYLFCTYPDAHEGRLSYMRS
KKVSNCNLYRLGKKKGLPSRMVVSIFDPPVNWLPPGYVVNQDKSSTDKVDSEETSKEELL
TNGRTGNDFDDDDDEDDTAEELDELMLKEEPKDEVNMEDDLEYYKEHIRFIDNMLLGSGA
FGKKISLSSFPHSLSPASGSCLESSYDWKVPKKPSHPAQFPSDPAPTGMSAEEFDYSSWD
AMCYLDPSKAGEEDDFVVGFWNPSEENCGTELGKQSISYDLHTEQCIADKSIADCVEALL
GCYLTSCGERAAQMFLCSLGLKGLPVKRVLCFCRLQVLPSEPGTSRASKAPSSRTSAADL
SYGWLKIPPRCMLAHPDAERTLQHLISGFENFEKKINYSFQNKAYLLQAFTHASYHYNTI
TDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKY
FKAISPELFHVIDDFVQFQLEKNEMQGMDSELRRSEEDEEKEEDIEVPKAMGDIFESLAG
AIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGK
VRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSLKANQPQVQNN
Download sequence
Identical sequences H2M5U0
ENSORLP00000013824 ENSORLP00000013824 8090.ENSORLP00000013824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]