SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000013935 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000013935
Domain Number 1 Region: 15-247
Classification Level Classification E-value
Superfamily eIF4e-like 6.67e-57
Family BLES03-like 0.000000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000013935   Gene: ENSORLG00000011109   Transcript: ENSORLT00000013936
Sequence length 248
Comment pep:novel chromosome:MEDAKA1:18:27024732:27025478:-1 gene:ENSORLG00000011109 transcript:ENSORLT00000013936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GIMEEEEASANGERENFASDHYAAEALAADMDPWIIFDCRKTPKSEFDAWLESNRPSQVH
RFGDEKSGVGPVGWISVRGPDYHPSDEDVEDLQESWEKLLASGRPVTFQTVKELALNHRV
LSGKWLMHLDSGFKLDHAWECVARATLEGKIWCAKVSPLDPKGDSRHVICVYNRNFTDEE
DVMKLDSVIRSTGIKCPLFYKPDVYTYLGIYRRNRWELSPTIYESRFDLECVPRRSHILN
KVTNLELT
Download sequence
Identical sequences H2M645
8090.ENSORLP00000013935 ENSORLP00000013935 ENSORLP00000013935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]