SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000014662 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000014662
Domain Number 1 Region: 723-985,1026-1181
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3e-70
Family DNA polymerase I 0.003
Further Details:      
 
Domain Number 2 Region: 263-301,349-419
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000607
Family DnaQ-like 3'-5' exonuclease 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000014662   Gene: ENSORLG00000011695   Transcript: ENSORLT00000014663
Sequence length 1228
Comment pep:novel chromosome:MEDAKA1:6:17119523:17128778:-1 gene:ENSORLG00000011695 transcript:ENSORLT00000014663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTRVIFAAVVGRPSALSAAPPPAHFQPTPAASPLPCYDQDVSSWNCSPQQKQQQEQKPDV
LNGEDSVETRLNPLKIQMLSKNLHEQIFRGVVPEYSEEAVERSIKHLQKHQLWGKETSLL
PDVELKLPQMYGKNIDEHFRILAEKQSLPYLEAVTKLLQAELPSMPQEWSWEVGWTRYGP
NGGTQKVDFPDESALVFDVEVCMTEGRCPTLAVALSPTNWYSWCSKRLLEERYSWSNQLS
LAELIPLETPLNSSRPPGGQWKERLIVGHNVSFDRSHIKEQYLLKGSIVRFLDTMSLHMA
ISGLTGFQRTLWMANKLGKKRGLQEVKEHIKKTGQKRDGPVIGSWDWVNISSINNLADVY
DLYVGGPPLQKEAREIFIKGNMTDVRNNFQELMQYCALDVEATHQVFTEQMPLFMESKRC
PHPVTFAGMLEMGVSYLPVNQNWHRYLEDCQDVYDDLQREMKKSLMTLADDACQLLQDAR
YKEDPWLWDLEWDVQEFKQKKVPTSKKKPAKKTAEAQVSTPLPDWEDDPGPPSEEETEGL
CPSRLAVEKLKETVNRLPKRRQHLPGHPGWYRKLCEKMSQEDGWSPGASLISLQMRLTPK
LMGLMWDGFPLHYTEKHGWGYLVPGRKDNLSPAGENTDPVCPHRSIERIYKEYCEQNRKV
QPKSLDSGDSDDLIWTDSSVWEKVEEMSSLENLSDENGIGTVQSDTKRNPLLFPEESHCH
YHHGNGPYNDINIPGCWFFKLPHKDGNHNNVGSPFSKDFLVKMEDGTLRAGRGGTNATLA
LEINKMMSFWRNAHKRISSQMVVWLRKGELPRNVSRHKDFDEEGQYGAILPQVVTAGTVT
RRAVEPTWLTASNARRDRVGSELKAMVQVPPGYHLVGADVDSQELWIAAVLGEAHFAGMH
GCTAFGWMTLQGKKSQGTDLHSRTADAVGISREHAKVFNYGRIYGAGQPFAERLLMQFNH
RLNQMEAASKARQMYALTKGIRRYHLSEEGEWLVNELGIDVQREEDGSVSLQELRRISKV
ASHSSRRKKWDIVGKRVWAGGTESDMFNKLESIAQSAQPATPVLHCRISRALEPKAVRNE
FITSRVNWVVQSSAVDYLHLMLVAMKWLFEEHNIDGRFCISIHDEVRYLVRSEDRYRAAL
ALQITNLLTRSVFAHALGLQDLPQSVAFFSSVDVDQCLRKEVIMDCVTPSNPTGLERRYG
LPPGEALDIYQIINITDGSLHKGRVPGF
Download sequence
Identical sequences H2M851
ENSORLP00000014662 ENSORLP00000014662 8090.ENSORLP00000014662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]