SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000014872 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000014872
Domain Number 1 Region: 63-231
Classification Level Classification E-value
Superfamily RNase III domain-like 0.000000000246
Family RNase III catalytic domain-like 0.015
Further Details:      
 
Domain Number 2 Region: 230-308
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00000149
Family Double-stranded RNA-binding domain (dsRBD) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000014872   Gene: ENSORLG00000011871   Transcript: ENSORLT00000014873
Sequence length 330
Comment pep:known chromosome:MEDAKA1:13:22450832:22453840:-1 gene:ENSORLG00000011871 transcript:ENSORLT00000014873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRAESRLVVSCRTLLAAAPARAAVRGEVREKKRWMKAYTFLMAKKLKLEGPPPPKPRW
QQPNWDYHAEVQAFSVRLQENFSLELLKTAFINPCYLRAERERREQLGVDSESTALSLKD
NVQLRNSGERFAKSFLSDWCRANFPRLPVVGVESIVGNLTSAATVSHVARNLGVEDLSMS
ADFPVPDEVLRSTFMALIGALKESSGAERTGFFLRDFLSTQLIGKDLFDLWTVVDPMGLL
VEELTERKCPLPEPRLIRAAGASTVLPLYFVGLYSDQKLLAQGPGETLVGAEEEAARVAL
RKLYGFTENRRPFDFSPQQLQQPLLQSVSN
Download sequence
Identical sequences H2M8Q1
ENSORLP00000014872 8090.ENSORLP00000014872 ENSORLP00000014872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]