SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000016792 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000016792
Domain Number 1 Region: 26-204
Classification Level Classification E-value
Superfamily eIF4e-like 3.79e-57
Family Translation initiation factor eIF4e 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000016792   Gene: ENSORLG00000013391   Transcript: ENSORLT00000016793
Sequence length 208
Comment pep:known chromosome:MEDAKA1:7:20672626:20676116:1 gene:ENSORLG00000013391 transcript:ENSORLT00000016793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVPVAALQLSSQHNLRDLGRVPHDSESDTLPLHSSWTFWLDRSLPGTTAAECESNLKKI
YTVETVQSFWRVYNNIPGVSSLPLRCSYHLMRGERKPLWEEESNAKGGVWKMKVPKECTP
SVWKELLLATIGEQFSDFCASEDEVVGVSVSVRDREDVVQVWNENAFCSNESNVLERIYQ
LLPQISFKAVFYKPHKEHHAFEGGRSRH
Download sequence
Identical sequences H2MDZ0
8090.ENSORLP00000016792 XP_004070877.1.28442 ENSORLP00000016792 ENSORLP00000016792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]