SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017054 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017054
Domain Number 1 Region: 875-904,962-1076
Classification Level Classification E-value
Superfamily RNase III domain-like 3.14e-34
Family RNase III catalytic domain-like 0.0008
Further Details:      
 
Domain Number 2 Region: 1109-1258
Classification Level Classification E-value
Superfamily RNase III domain-like 8.2e-31
Family RNase III catalytic domain-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017054   Gene: ENSORLG00000013592   Transcript: ENSORLT00000017055
Sequence length 1378
Comment pep:known chromosome:MEDAKA1:20:22465578:22548452:1 gene:ENSORLG00000013592 transcript:ENSORLT00000017055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTYDSFCADMSFHRDSGGPRGGMPPGQHSSAQTFRPTNMRTPPPQPHVPPYHYDPQATPS
SGYHGGYMPPDFMHYPPPAPPQTPGSVSQCPVRPPFPKSTARQGFQEPPPNFPPPPLPSS
AGGPGPRVQVSAHSSYHPFMMPPPPLPRPPMPPPISSQSMNYNLPYPMNYPPFPPPTFMP
SYSQSPGPFQPDHGARHGGQFKYEKPPESRRSPERSFYQDGRQKSYCYSGDRRKMEFSGD
RKDHGRSPDRNSRPEGGRYRSPLRPRSRYQPVLQIRIERYRHRDRQRSPSPDKHRKRPRS
QPVQESNAAMVSSASVCLEFQNKTELKSLSCFNQSLPLFRSRSSSRDRKRSRWEEEKERR
SEGSFSRERSYSSLRTRDSEEASDRERERDREREAAKAEEEKDEDDLLKPAWIRCTHAES
YYSNDPMDQVGDSTVVGTSKLRELYERFEEELGKRQERAKEARPKWEPPKTKLDEDPDDS
SSDSDCESDEDGSSCSSSSDSEVFDVIAEIKRKKAHPDRLHEELWYNDPGQVDKGPYCTV
LRKPRQLLGEQADRRGEKPVKPCRPMNNNAGKLFHYRITVSPPTNFLTDRPTVIEYDDHE
YLFEGFSLFSHTPLTSIPLCRVIRFNIDYTIHFIEEMAPENYCVRGLELFASYLFQDILE
LYDWNLKAPDSEGEASGCQQFHFMPRFVRFLPDGGKEVLSMHQVLLYLLCSSKALVPEEE
IADMLQWEQLDWQKYAEECKGMIVTNPGMKPSSVRIDQLDREQFNPDVITFPIIVHFGIR
PAQLSYAGDPQYQKLWKSYVKLRHLLANSPKVKKLDKQKLSQREEALQKIRQKNTMRREV
TVELSSQGFWKTGIRSDVCQHAMMLPVLTHHIRYHQCLMHLDELIGYVFKERCLLQLAMT
HPSHHLNFGMNPDHARNSLSNCGIRQPKYGDRKAHQMYMRKKGINTLINIMSRLGQDDPS
PSRINHNERLEFLGDAVVEFLTSSVHLYYLFPSLEEGGLATYRTAIVQNQHLAMLAKKLE
LDRFMLYAHGPDLCRESDLRHAMANCFEALIGAVYLEGGLDEARLLFGRLLFNSEDLREV
WLNYPAHPLQVQEPQTDRQLIETSPVLQKLTSFEDSIGVFFTHVRLLARAFTLRTVGFNH
LTLGHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKVAEELGMQ
EFAITNDKTKRPVALRTKTLADLLEYACGCIXINESLSKAHEEEKRCPSPDLEEFILNQD
WNDPKSQLQQCCLTLRTEGKEPDIPLYKKTLPSLPASSLRHSVIVYHRQTLLGCWLKNGL
VLEPEPLPAMLLTEEDNFPQMAHQKRFIERKYRQELKEMRRERERQEKESDEAEECRK
Download sequence
Identical sequences H2MEP2
ENSORLP00000017054 ENSORLP00000017054 8090.ENSORLP00000017054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]