SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017169 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000017169
Domain Number - Region: 37-136
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.0083
Family Reverse transcriptase 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017169   Gene: ENSORLG00000013687   Transcript: ENSORLT00000017170
Sequence length 158
Comment pep:novel chromosome:MEDAKA1:11:26274910:26278146:-1 gene:ENSORLG00000013687 transcript:ENSORLT00000017170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLKSLCSPNTVARIKVKTYESSRNTINPSLLRRKLEVAGVDQHLVAWTINYLTDRPQFVR
LHDCVSDVVVCSTGAPQGTVLSPFLFTLYTSEYTYNSHHCHLQKFSDDSAIVGCVSGGDE
QEYRGVISDFVGWCSNHLLLNTSKTKELVLDFRSFPYT
Download sequence
Identical sequences H2MF03
ENSORLP00000017169 8090.ENSORLP00000017169 ENSORLP00000017169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]