SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017467 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017467
Domain Number 1 Region: 618-708,778-873
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000000834
Family RNA-dependent RNA-polymerase 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017467   Gene: ENSORLG00000013929   Transcript: ENSORLT00000017468
Sequence length 1103
Comment pep:known chromosome:MEDAKA1:11:26557148:26566572:-1 gene:ENSORLG00000013929 transcript:ENSORLT00000017468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMTSGDLSSVLNILRSLYKRTRTLEEFADGVVFREGRRAALLQPSDTHSFKSFVRGVFVC
SDEELQDVPSCNQPPQTCTFPELLAFILNSLKRKRRRNVLAHGYNFLGVAQEDRDADHFR
FQGDLSQSAAYIHSSDLWKKVTARLGTDVTRYLLGSCSVFVLAPPSCVFQICGVPAYDRV
SMTTASSGFLLRPPSRKHKSFQVGKKTRSANLTKTGSVGDVEESRKRRRVESEVSTRKRK
RESEEEESRERRRGVHHEERRQHEAVLDESTLSGKSGENDAAAVKPPPETSAAPPPLEGG
PSWRSGAFPPLPSSQCFIRTLGFLYGGRGMHGFCLNRKRRTAAGPRRLQGQDLVRLVFFE
GLPYLNGQERKPKKLPLRYFNMVPVFGRLLQRHRKCRYSSVLHRMCPVVELSRAAQGELS
SLIPQHCAPHRVYLFVRECLTAVVPEELWGSDHNRLQFFSRVRGFLKSGKFERISVAELM
WKIKVMDCDWLKLRRTAGRFPPSELAYRTRILSQFLTWLLDGFVVGLVRACFYATESVGQ
KNAIRFYRQEVWSKLQDLAFRRHIAKGEMEELSPAQVASLPKGTVISQLRFIPKTDGMRP
ITRVIGADSNTRVHTDEISSVLLHHKRIRDLMSMLQARVRSAPALLGSTVWGMTDIHKVL
RSLAPAQKDKPQPLYFVKVDVSGAYDSLPHDKLKEVITEALSPVQEEVFTVRHYAKIWAD
SHEGLKKAFARQVQIQSMGSTSMKGFVMSLQKSSKVHHAVLVEQAFGSNLRGKDALQFFT
QMLTGSVVQHGKKTYRQCRGIPQGSVVSSLLCCLCYGHMENVLFRDIKNKGCLMRLVDDF
LLITPDRNQAQSFLRYILLAGVPQYGVVANPQKVVVNFQGSEGGGAFPDIRVLPPHCLFP
WCGLLLDTRSLDVCKDYSSYAGLSLRYSLTLGSAHSAGQQMRRKLMSILRIKCHPLFLDL
KTNSLESAYKNIHKLVLLQACRFHVCVQSLPFAQTVAKNPTYFQQMIWDMAHYANALIRR
SNTGLVLGDGAQKGSVQYEAVELLFCLAFLRVLSKHRPVYKDLLPRLHKWKRRLERLLGD
LRLARVRQAANPRALLDFLAMQM
Download sequence
Identical sequences A0A140TAW2
ENSORLP00000017467 ENSORLP00000017467 8090.ENSORLP00000017467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]