SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000017538 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000017538
Domain Number 1 Region: 951-1375
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.56e-149
Family Reverse transcriptase 0.0000273
Further Details:      
 
Domain Number 2 Region: 598-752
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.67e-36
Family Retroviral integrase, catalytic domain 0.0052
Further Details:      
 
Domain Number 3 Region: 147-229
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.98e-20
Family SCAN domain 0.00098
Further Details:      
 
Domain Number 4 Region: 319-403
Classification Level Classification E-value
Superfamily Acid proteases 0.0000000000457
Family Retroviral protease (retropepsin) 0.011
Further Details:      
 
Domain Number 5 Region: 270-298
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000767
Family Retrovirus zinc finger-like domains 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000017538   Gene: ENSORLG00000013992   Transcript: ENSORLT00000017539
Sequence length 1392
Comment pep:novel chromosome:MEDAKA1:21:15858883:15933621:-1 gene:ENSORLG00000013992 transcript:ENSORLT00000017539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARDLQLQEEAKRQEHRLKALQHQFQLLQMEVQDLLSNWTFRKKSKAPDPPDVSNFDNQPS
PPTSAPECEPPAPSQPHFSREQWLEKLSENDDVEHFLVTFERMATACKWSRSDWAFRLIP
LVTGKARSAYVGMDFDDSKYYDKVKTASYRQRFCSLEVGPEETPKELYARLKELYDKWIQ
PKSKKTKEMAEIIIMEQYLRMVSPEPQIWIKEHGPNSAAEVASLAEGERKSFHGATLHGR
PSKTLEGQQTINTTRGTNRTPLGEDKQTRPAKPSSKTQICYLCGQEGHIKPLCPKNPVKL
TQMCLVPYQRLPPETQEGESMSLTTVRINGKSHKALVDTGSTHSRAETACTSRETISICC
VHGNRKIYPTAELYIEVQGQTLLNVGVVDDLPFPAVLGHDLPVLFDLLDTKGNSNVAVTR
AQTQVEEEQSQLLSALPFYDAELETNPGKSRKPRSQRRQEKFKHTAVKPTTETTPDSALG
FELPSDISKMQQDDPTLLFCFLKAKELTESKKRREFFPHDGVLYHQRGQTKQLVVPQSVR
DVILNLGHSIPWAGHLGKHKTTARIVKHFYWPGLHADIDKNCKSCPQCQKTSVKVQPLPI
IGTTFERLGMDMVEPEERSRAGNPYTLVITNYATKYPEVFALKCVKAKAVAFSLVQFFSR
VGFPKEILTDRGTNFMSTLLKQVYQLLGIKSIPTTPCHPQTDGLTDRFNQTLKQMLRKFV
NDTGSDWDQWLPYLLFAYREVPQASTGFSPFELLYGFEVRGPLTLLRETWGKDQGREGPV
NVVSYVLQMRGKLQKMSELAQDHMADAQRYQKTWYDRKARHKSFLPGQKVLVMLPTSDSK
LLAKWQGPFVVHKKLGATTYQVSTPDHARSSRVLHVDLLKEWFPRAEEEAKEVFCHQNLI
LGATQCPPDERDQGFPTEKQVSSVVAVSHVHVWRQRFVARNLSQHCFDERQTFCTFVQIF
IHLCHGTQPPKGHIYPVSLPEREAMEEYLQESLQAGIIRPSSSPAGAGFFFVGKQDGGLR
PCIDYRGLNNITVRNTYPLPLLQSAFDLVKGSQIFTKLDLRSAYHLVRIREEDEWKTTFN
TPSGHFEYLVMPFGLTNAPAVFQCLINDVLKDMINRFVFVYLDDILVFSPDLNTHVQHVR
AVLQRLLENQLYCKAEKCEFHTTWTKFLGHVITPGSVQMDNAKVKAVLEWPVPSGRKQLQ
RFLGFANFYRRFIRGFSGVAAPLHRLTSAKVRFVWDEGADKAFDGLKRRFSASPILTQPD
TSKQFIVEVDASESGVGAVLSQRASDNKIHDQPFLYFSCKLTPAERNYDIGNRELLAVKL
ALEEWRHLLEGSDQPFLVWTDHKNLEYIRAAKRLNPRQARWALFFDRFNFSISYRPGSKN
IKADALSRQFQR
Download sequence
Identical sequences H2MG10
8090.ENSORLP00000017538 ENSORLP00000017538 ENSORLP00000017538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]