SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018080 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000018080
Domain Number 1 Region: 13-104
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000534
Family RNA-dependent RNA-polymerase 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018080   Gene: ENSORLG00000014429   Transcript: ENSORLT00000018081
Sequence length 107
Comment pep:novel chromosome:MEDAKA1:21:16871118:16953312:-1 gene:ENSORLG00000014429 transcript:ENSORLT00000018081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQNRFHTSRPTDFKDYRPVALTSHLMKTMERLVLTHLRPMVSQSMDPLQFAYQPGIGVE
DAVIFLLDRALSHLDQTGSSVRVMFFDFSSAFNTIQPLLLRDKLVHM
Download sequence
Identical sequences H2MHH2
ENSORLP00000018080 8090.ENSORLP00000018080 ENSORLP00000018080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]