SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018167 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000018167
Domain Number 1 Region: 52-420
Classification Level Classification E-value
Superfamily AF1104-like 2.75e-49
Family AF1104-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018167   Gene: ENSORLG00000014496   Transcript: ENSORLT00000018168
Sequence length 444
Comment pep:novel chromosome:MEDAKA1:24:8571102:8574468:1 gene:ENSORLG00000014496 transcript:ENSORLT00000018168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVVQRGVPPSLSAKVTGSFAYLTIRDRLPTILTKVIDTIHRNKSKFFEEHGEEGINAEK
QAIALLSKLRNELLTDKPVIELTDGLEDADSWNEYLQRQQRLQGDQEPVSWFTSPWLYVE
CYMYRRIQEAVSLNPPISNFDVFNEGKTQSFYESQKAVMTLCTFLEDIQKNAEKLSPDRL
SEDFNKLLQISLWGNKCDLSISAGQDNSQKISPIDALASLQPFILVNDSGMVWSSLMSSQ
RAGESVDRVDIVLDNAGFELVTDLVLADFLVSSGLVRKIYFHGKSFPWFVSDVTANDFHW
TVRQTMAANHKWMSKRGFQWQNYLKVGAWSYHDHPFWTQPHEFCDMAADAPDLYSRLQQA
DLVLFKGDLNYRKLTGDRAWDHTVEFSTALQGFQPAPLCSLRTLKANVQVGLQPGRGEKL
TSRDPTWMTNGKYAVIQFYSPKPV
Download sequence
Identical sequences H2MHQ1
XP_004083652.1.28442 ENSORLP00000018167 8090.ENSORLP00000018167 ENSORLP00000018167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]