SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018389 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000018389
Domain Number 1 Region: 57-236
Classification Level Classification E-value
Superfamily L domain-like 4.42e-37
Family Ngr ectodomain-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018389   Gene: ENSORLG00000014673   Transcript: ENSORLT00000018390
Sequence length 288
Comment pep:novel chromosome:MEDAKA1:4:27925658:27948509:1 gene:ENSORLG00000014673 transcript:ENSORLT00000018390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEPSAQSLRLLFLFVFVMGVAPSPALTAGCPDRCVCDDQLVVQCAGQDLTLFPNDLPLAT
RQLIISNNRIGDLPALQLNYLSDLVYLDCSNNSLTEISESTFGNLRKLAYLDLSFNTLLQ
IEDRTFGPLASLVMLRLTDNPGLGEIHPDAFLENMALQVLDVSRNNLTTLNISSLIALPA
LRSLGLSGNPWRCDCDTEDLCLWVKIEGFKFQDEGQTVCFNPPELAGQRLAEVGMQLRVD
CHQGLGYWDYLFFIAIGFVIFSAGTVSAWVMGILMVLYERYTKRKSEE
Download sequence
Identical sequences H2MIB5
8090.ENSORLP00000018389 ENSORLP00000018389 ENSORLP00000018389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]