SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018452 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000018452
Domain Number - Region: 65-147
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.0004
Family Reverse transcriptase 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018452   Gene: ENSORLG00000014720   Transcript: ENSORLT00000018453
Sequence length 167
Comment pep:novel chromosome:MEDAKA1:21:17842000:17843017:-1 gene:ENSORLG00000014720 transcript:ENSORLT00000018453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLEHLEHKNTYARLLFVDYSSAFNVIRPFNLQAKLHHLGLNTALCNWTTDFLTNRKQSVR
VGKYTSSTVFINTGAPKACVLSPLLYSLFTHDCCSSSSSNLIVKFDDDITVLGLLNNNNE
TDYRKEVQHLASWYNNNNLILNITKTKEIIVDFRRCFPPSNCPPPHP
Download sequence
Identical sequences H2MIH2
8090.ENSORLP00000018452 ENSORLP00000018452 ENSORLP00000018452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]