SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000018995 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000018995
Domain Number 1 Region: 2364-2821
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.61e-110
Family DNA polymerase I 0.0000383
Further Details:      
 
Domain Number 2 Region: 25-174,2101-2147,2179-2363
Classification Level Classification E-value
Superfamily Ribonuclease H-like 5.08e-65
Family DnaQ-like 3'-5' exonuclease 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000018995   Gene: ENSORLG00000015155   Transcript: ENSORLT00000018996
Sequence length 2938
Comment pep:novel chromosome:MEDAKA1:24:9567322:9602566:1 gene:ENSORLG00000015155 transcript:ENSORLT00000018996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSVRIVTADYYLASPIKDLDVSYSSFRESDVKRVPVVRIFGATPAGQKTCLHLHGIFPY
IYVPYDGCGQPPERHLRQVAFSIDRALNVAMGNPASSVQHVFKVVLVSGMPFYGFHAKEK
HFMKIYLYNPQMVKRVCELLQSGAVMNKSYQPHEGHIPYLLQLFIDYNLYGMNLINLAAV
KFRRSHNRDYKWMTLHWTTQSPCNSKLNDSTIGGTYVVWEENTLPSSLVLDEVGKQSTCE
LEVDAVAVDILNRLEIENQVGRNPGLQAIWEDEKQRRRKREQSSQIESPDSQDRGFVAST
DSETIFLKRLKEILRENHFDVTQDQSARDEQDHFLADLTLHPEGLTPDGPQCTPANAVEE
HRDSQPDSLRPSGKVPDEAVVDEEAILDLLESSQTFLPVSQSSNHSALLADGSRDHAIID
LLAGLEDDGFHRTPISQNSQHRSLSDARSNPYNSDEEEAEPDINREEAELSVMMSQRWDN
GPAETSQRPKGKEAEDGLSDDQQDASDEDMEWSGNSSLFADLSISQLDGAADESSGKFLI
KNSSLTDSGSISQSSLAVTELVGQRNPSSAKVLSECKHPEHRPVHMLDTDQPLDVRFQLK
SSQGDGNECSAGFQINKEMPYIQPVKHPISCTLTSNPDKASMDKEDIRPLCPYDKKSSIP
VDKSELEGLPFGSDNITKSRKIYGSIEHVGTNCLTILQKHGSFLCYSELKSKTELDLSTM
DSKSQVLTSISSSPMKEDGFVNPQKEEMGQETEEGDVGELKIRYEDYQENKTEKTIVAQQ
EAHYKFFPSVILSNCLSRRKAGNKKPVDNQELSPSRRSKLKTSKKRLGMAGHRNKTKLSH
DSTSTGTSNLTSSSLHSVTVETEELVDQPTVEAQSIGDEPMVPKDFKEQILSPDEDLAAK
VTCTKPSALPGSKYSLRAKRKTVCDGEDGEHSGPTQSKISSSVKKRLKETNVAGGLHVKD
QKKRKKEPPIIIKYIIINRFKGQKNMLVKISRMKSGEQSVQLTPDKLEQYNKLAPLKDFW
PKVPESPAVEFPVIELKAKKTPKRKVKVNSTNKKTPQKGLNNTSKHWLKRGRGVKRAKGC
QRGPVLPSLPPPRPCYCELTDDRDNDYKDVMVELGYLSDTSLSPAESTPPRCWSPSDPLM
YSSSEQLINPLNDPCLSSAFHKPQKMSSTKGAQRRTPKPKKPPETKRKVRKSAAKPPETD
KPQKENSKRCAATRWTKKVETKTGSPKTAGRQRRSRKKKTGEPEICDLSKDGSQLLFLEN
EPLPSEGSSQEVPPFQQPVDSEGISQAGSQPTPSSDSNSIAQIIKPKVEDCDTSIMEINQ
SLLGPSETKQQGCQTVVVKTEEESTPPLLSHASQASLEHTKDTKLPEVSPNSGPKNGETQ
PLPDTTSGLAVLKQLLQKRQQGQALPTQVVGTNSHATVVAKATALLSPTAKLPKSRKAPS
TTPRKPRTPKSATPKDKKQEPRGKQNKKAREGSFLDDCPLFLSDPEQDGCSCMEGSLSPE
LPHNYSFDINDISRTDFSSPYTGSQFVLTDKNLPVKFLSDISQEAVSAQTIGFEDLPQSQ
VSSQKGLEGDKSRPASPDLFDKFERRQSSSSLALLDSEKLKSRDWDGTSNKFSNRSPFQD
FHCEREELLFSALDPVPPLALSSASLVEHEGSPTSDLLDGLDGLTSTTPSSSPQSSSSSL
SQARASQLQRATGGGAHILKPLMSPPSREEILSTLPDLELSEATFQEPFCSDPSDAPGKP
MEVGGRKLSVETRLVKELAEFSGELSQEGLRFWKMAFSAMTRPAAAIVSSPQDAEAAEEL
VSSSASNKKVILLPCRNPPSRECVQLWLEARRQYESLQNRRRDGIPSKMGQPAGSACPAL
KVEQGENQNRIRTQRRRNLNLSLNVTPVRNTGSQCGSTEQSPVSEDGSSGDKDEDPKSTS
PDSPDLPPWQQSVQPSSPDTNRLSDLNRTPTERSPGIPNLQEGVGGANSPSSLHGSDVED
DGASPRLNCTPFSRKRRRFMEDQDPMCSTPISEDYLFTRLSERSCNSLSGDSVSPRLQRR
RSQADPLRRVLLTTQMKNQFAGLNVPKKEHSQIEGPSISNSYGFKVSMQNLQDAKALHEV
QHLTLMAMELHARTRRDLEPDPEFDPICALFYCFSSDAPLPDADSTQLTGAIMVDKDHEP
GGRGRRETAPLLVRSGVSGLQVTYASEEKMLFQELVGIMRRLDPDILLGYEVQMHSWGYL
LQRAAVLGVDLCQQLSRVPGDSKENRFAAEKDEYGADTMTEIHIIGRVTLNLWRVMKSEV
ALNSYSFENVAFHVLHQRFPLFSHRTLSDWFDHNTNLYRWKMVDHYVSRVCSSMHLLQQN
DIVGRTSELARLFGIQFLHVLTRGSQYRVESMMLRVAKPLNYIPVTPSVQQRAQQRAPQC
IPLVMEPESRFYSNSVLVLDFQSLYPSIVIAYNYCFSTCLGHQESLGTPDEFKFGCTSLR
VPPEMLYQLRNDINVSPSGIAFVKSTVRKGVLPRMLEEILNTRIMVKQSMKTYKQDKALM
KLLDARQLGLKLIANVTFGYTSANYSGRMPSVEVGDSIVHKARETLERAIKQVNDTKKWG
ARVVYGDTDSMFVLLKGATKEQAFRIGNEIAEAVTATNPKPVKLKFEKVYLPCVLQTKKR
YVGYMYESLDQKEPVFDAKGIETVRRDGCPAVSKILERSIKLLFETRDISQVKQFVQCQC
LKVLDGRASMQDLTFAKEYRGSGSYRPGACVPALELTRRMLSYDRRLEPRVGERVPYVVV
YGTPGVPLIQLVRRPLDVLQDPTLRLNATYYITKQILPPLARMFQLIGVDVFSWYQELPR
VQKASCSAAAAGDEVGRKGTISQYFTTLHCPVCDELTQLGVCSQCRAEPQRVAVTLYQDM
RQWESQQEQLLKICRSCSGGTERQVPCISLDCPVLYKLSRVNRQISKAPYLRQLMEQF
Download sequence
Identical sequences H2MJZ2
8090.ENSORLP00000018995 ENSORLP00000018995 ENSORLP00000018995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]