SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000019522 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000019522
Domain Number 1 Region: 5-212
Classification Level Classification E-value
Superfamily DNase I-like 1.7e-16
Family DNase I-like 0.093
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000019522
Domain Number - Region: 409-535,570-672
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.000145
Family DNA polymerase I 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000019522   Gene: ENSORLG00000015591   Transcript: ENSORLT00000019523
Sequence length 899
Comment pep:novel chromosome:MEDAKA1:3:36401469:36468353:1 gene:ENSORLG00000015591 transcript:ENSORLT00000019523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNYDVIKCGLLNIRSISSKSLLVNELIIDNNLSLLALTETWLQQDDYVRLNEATPPTYAN
YQKSRISGKGGALAVISQSSLLLSPKVKNAYNSFENIILSINHPNRIIYRPPGPYSEFLT
EFSDFLSTIVLDSDQTIILGDFNIHVDDPSDCLGKAFAALLMIGFTQSVNEPTHCHKHTL
DLVLTHGIEISQLSVLPLNPIISDHFLITFQFTLEHPSAPVNKKQLRRTLTDRSVSEFKH
TVQPVLSDILRKYSESSSHSISPSINDHFVNDAFQALRSTLHVVAPLKQNRVAPWFNAET
RSLKQETRKLEREWRRSGSEQSLDIWKHSLLNYKKALRRARSQYYSTLISENGNNPRFLF
SPEQAEVVEMEASIETSVTLDCFTAVDQAEITSIITSTNPTCLLDPIPTKLFKETFPLIN
DPILTIINTSLETGYVPQSFKYAVVKPLLKKPSLDPSILANYRPISNLPFISKILERVVV
EQLYCHLQDNSHFELIRKVFRNIHRTESRLLEILSLTSAYSCMACLIVQNLGLHSLQFTK
GLEISRLEKDTGVWQQQTLFWYFFFLEITYHHFHFTGSQLAPTKLPAHQGSVLTTLLFTV
TCIPLGDHEQMHGINIKCREEISHFYFSSLIDDLGLLKNLNSCIADIKTWMAQNFLQLNM
DKTDVIIFGSVEARNGVAQNLESLSNNVSSSCRNLGVIFDTDLNLETHLKSVVKSCFWQL
HRLYRITPLLSKKCLEMVIHAFIFSRLDYCNALYTCLSQQSVYQLQLVQNAAARLLTRTR
MRDHITPVLASLHWLPVRFRIYFKILMIAFKAVGGLAPKYIADLLIPYVPGRNLRSSTKG
LLTIPQSRLKTRGDRAFALRAPTLWNSLPEKIRLAGSLPVFKSLLKTYLYRRAFNDFTG
Download sequence
Identical sequences H2MLE5
ENSORLP00000019522 ENSORLP00000019522 8090.ENSORLP00000019522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]