SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000021028 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000021028
Domain Number 1 Region: 19-81
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.42e-16
Family THAP domain 0.0016
Further Details:      
 
Domain Number 2 Region: 124-161
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.000017
Family KorB DNA-binding domain-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000021028   Gene: ENSORLG00000016806   Transcript: ENSORLT00000021029
Sequence length 214
Comment pep:novel chromosome:MEDAKA1:7:27678712:27679835:-1 gene:ENSORLG00000016806 transcript:ENSORLT00000021029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSKKTFKFQRTIYSTAEHCCVPLCQASSKYNSLLSFHTFPSDAEIRRKWLVAIRRDKFT
VTPHTRVCSRHFNKDELYLFRFASYDLLMRFWALIEPSLPNMVSVTQAQRGTFTEPSSTV
TRFLQPMDEMFMFLNYLALGSKQRDLADRYGVHQSTVSRIITTWSNFLYTVLGSVRIWIP
EEKIRAHLPAEFKDYADTTVILDCTELRCQCPSS
Download sequence
Identical sequences H2MQK8
8090.ENSORLP00000021028 ENSORLP00000021028 ENSORLP00000021028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]