SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000023101 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000023101
Domain Number 1 Region: 15-143
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00000612
Family DNA polymerase I 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000023101   Gene: ENSORLG00000018465   Transcript: ENSORLT00000023102
Sequence length 278
Comment pep:novel scaffold:MEDAKA1:scaffold993:4099:5825:1 gene:ENSORLG00000018465 transcript:ENSORLT00000023102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FDLDGGGGMVRITFFDFSSAFNTIQPSLLGDKLRLMGAGASTVSWITDYLTDRPQFVRLG
GVRSDVVLSGVGALQGTVLSPFLFTLYTSDFQSCHLQKFSDDSVVVGCISSGWEEEYRRL
VDGFVEWADQNHLLLNVDKTREMVIDFQRKGTVLQPLCILGKDVEAVEDYKYLGVTIDSR
LSWRSHSTAVYKKACSRLYFLRKLNSFNVCSKMLGIFYQSVVARTLVSSVVCWGSSIAVS
DTNRLNKLIRRLKQLRSKTARYQKSFIPNTITLYNNSQ
Download sequence
Identical sequences H2MW82
ENSORLP00000023101 8090.ENSORLP00000023101 ENSORLP00000023101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]