SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000023353 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000023353
Domain Number - Region: 437-588
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.0178
Family RNA-dependent RNA-polymerase 0.056
Further Details:      
 
Domain Number - Region: 291-319
Classification Level Classification E-value
Superfamily Ribosomal protein L19 (L19e) 0.0445
Family Ribosomal protein L19 (L19e) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000023353   Gene: ENSORLG00000018690   Transcript: ENSORLT00000023354
Sequence length 694
Comment pep:novel scaffold:MEDAKA1:scaffold3404:1324:4902:1 gene:ENSORLG00000018690 transcript:ENSORLT00000023354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMNLFESLRKSIGQLCMRELRRLEKLERKRARQKNHLRFNLCCRDEGIIPTSLKIKNPIR
TDNAEWMIKRVRRALAKERIRCTTNKINILETQLERELQDFTQRHSLKETEKNLRGHLRN
VHNSEYEKTKTRHIQKLEKLIAKAAKKQEHKNTIDDKWICNLSKHTLSEAERSVLSYGLN
FAITPKQIPHEESINSATELAGERIHDPGEKAALRNEIAGILKTAKLPPSNITKKEMAAI
HNLKNNREITILPVDKGRTTVILDTEQYEKQMDEILHDRNTYEALKKDPTEAKKKKLKTI
LKQLQDEKKIDKQTYNHLIPTANIIPRIYGTPKIHKPGAPLRPIIDSMGSVTYNLSKFIA
DILKPLLGNTDYHCENAKQLAEEPKETKMEANEIFISDDVVSLFTRTPVEATLQIVQEQL
TADKSHSKRTNLTVNDITQLLHLITTSTHFQFRNTIYRQKEGFPMGDPLSATMCNFFMED
LEKKAITSAPEHCRPTLWKRYVDDILEKIKTGHTQEITDHLNTMDDTGQIKFTHEEEKDN
SINFLDINITHTENRDIKIKIHRKPTHTDQYLLWTSEHPTTHKISVVRTLFDPAELVTER
EDKTEEKKHIQNALTRCQYPKRAIKKGQTQVEQKKYKEAENKGMVTLPYIRGITERIQRA
MKKHHISTPVKPYKKLGQTVHPKDKXPPPSQSAV
Download sequence
Identical sequences H2MWU1
ENSORLP00000023353 ENSORLP00000023353 8090.ENSORLP00000023353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]