SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000023455 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000023455
Domain Number 1 Region: 2-43,70-114
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.0000786
Family Reverse transcriptase 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000023455   Gene: ENSORLG00000018780   Transcript: ENSORLT00000023456
Sequence length 512
Comment pep:novel scaffold:MEDAKA1:scaffold3849:4190:5728:1 gene:ENSORLG00000018780 transcript:ENSORLT00000023456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLAFADDLVLVSDSEEGMGRSLGILEKFCQLTGLRVQPRKCHGFFMDKGVVNGCGTWEIC
GSPIHMIPPGESVRYLGVQVGPGRGVMEPDLIPTVHTWIERITEAPLKPSQRMRVLNSFA
LPRIIYQADLRKVTVTKLAQIDGIVRKAVKKWLHLSPSTCNGLLYSRNRDGGLGLLKLER
LIPSVRTKRIYRMSRSPDIWTRRMTSHSVSKSDWEMLWVQAGGERGSAPVMGAVETAPTD
VERSPDYPDWRREENLAWSALRVQGVGADQFRGDRTSSSWIAEPASVGFAQRHWLAALAL
RAGVYPTREFLARGKEKSGAACRRCPARLESCSHILGQCPFVQANRIARHNKVCVLLATE
AERFGWTVIREFRLEDAAGGLKIPDLVCKKADTVLIVDVTVRYEMDGETLKRAASEKVEH
YLPVGQQITDKVRGRCFKVMGFPVGARGKWPASNNTVLAELGVPAGRMRTFARLVSRRTL
LYSLDILRDFMREPAGRGTRVALIPAATGAAN
Download sequence
Identical sequences H2MX16
ENSORLP00000023455 8090.ENSORLP00000023455 ENSORLP00000023455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]