SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000023648 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000023648
Domain Number 1 Region: 48-162
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.0000578
Family Reverse transcriptase 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000023648   Gene: ENSORLG00000018953   Transcript: ENSORLT00000023649
Sequence length 264
Comment pep:novel scaffold:MEDAKA1:scaffold223:25406:27800:-1 gene:ENSORLG00000018953 transcript:ENSORLT00000023649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQPSLLGDKLRLMGAGASTVSWITDYLTDRPQFVRLRVLSDVVLSSVGAPQGTVLSPFLF
TLFSDFQYNSESCHLQKFSDDSVVVGCISGGREEENMRLVDGFVEWAGENHLLLNVDKTR
EIVIDFRRKGTVLQPLCILGKDVEVVEEYKYLGVTIDSRLSWRSHSTAVYMKACSRVYFL
RKLRSFNVCSKMLGIFYQSVDKQQSSFSRRLRQLRSQTARYQKSFIPNAITLYNNSQCKR
QPFNDGFQPQRFMLNTPLHMQIYL
Download sequence
Identical sequences H2MXI2
ENSORLP00000023648 ENSORLP00000023648 8090.ENSORLP00000023648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]