SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000023992 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000023992
Domain Number - Region: 27-101
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00311
Family Reverse transcriptase 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000023992   Gene: ENSORLG00000019260   Transcript: ENSORLT00000023993
Sequence length 157
Comment pep:novel ultracontig:MEDAKA1:ultracontig105:216182:217512:-1 gene:ENSORLG00000019260 transcript:ENSORLT00000023993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCDWPLDFLTGRPQSVRIGNRTSASIITPQCCVLSPILYTLLTHDCVASHKDTIILKFAD
DTAVLGCITGGDKGAYRREVASLLAWYEDINLTLNKDKTKEMIVDTRKGGCGEGEQPQIS
GGPPQPGPHLDTKHVTAGETLALRADSNVRISLYRET
Download sequence
Identical sequences H2MYB5
ENSORLP00000023992 8090.ENSORLP00000023992 ENSORLP00000023992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]