SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000024090 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000024090
Domain Number - Region: 526-656
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00534
Family Reverse transcriptase 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000024090   Gene: ENSORLG00000019349   Transcript: ENSORLT00000024091
Sequence length 782
Comment pep:novel scaffold:MEDAKA1:scaffold645:94622:105454:-1 gene:ENSORLG00000019349 transcript:ENSORLT00000024091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALLFVQNWVERSLLSDQSLTLPGFVTVQVDRDATASGKKKAGGIILYMNKRWCNPTVCVK
ERLCSPNVEILAADMWPYYLPREFTSAIVVTAYISPSAEADNHTDLQEHQPNAFIVITGD
FKHVTLSKFTQYVDCPTRVNKTLDLLYANAQGAYSTIRVRRMSLSKRKVKKWTQEAEETL
QDCFECTDWDTLPHGEDISSMTDCITDCLPLITSDLKGLLNKKKRAFRSGDKEWLTMVQH
QQRDKLREWKNSYKGKLEQNSSKTEVWSGMKKIAGCGGRSRLCEGDRERANYLNNIFNRF
SSPTAQINPTPSSDIFTTHPPFLMQLPPHPLLPDPPCAHLTKLNPPPTPRILKSCATRLS
TVFQRLFNMSLSLERMPATWKTACLVPVPKRPPSGLSDYRLVRLSTIGARPYDRQLLHRT
VKVTVNVLKLPLYFFFSSFYTAMCFMLMQILKYTLYFIKKFKLYQQVSIVSFESSFIVLK
SQLGTRKWSRLEVPDRCETLERFWSGSLRQTKIFERYGPPPRTLNIGAPQGCVLSPLLYS
LYTYDCSPAHNNNCIIKFADDTTVVRLIPRGDESAYRDEVLKLTTWSSENNHPGKTREII
VDFRKHGADPTPLLINGEHVEKVHTFRFLGITISADLSWTANTTALTTAIIKKAQQRLHF
LRVFRKNNISTNRLLTYQSSIQSLLTYCITVWFGRCTAADKKSLQRVVETAQKIIGCPLP
TLTDIYSARSITRVHNIIKDSSHPGSDLFNLMPSGRRYRSIRSKTNRLKNSFFPKAITIL
NS
Download sequence
Identical sequences H2MYK0
8090.ENSORLP00000024090 ENSORLP00000024090 ENSORLP00000024090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]