SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000025217 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSORLP00000025217
Domain Number - Region: 67-138
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.00385
Family DNA polymerase I 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000025217   Gene: ENSORLG00000020344   Transcript: ENSORLT00000025218
Sequence length 162
Comment pep:novel ultracontig:MEDAKA1:ultracontig95:214399:215575:1 gene:ENSORLG00000020344 transcript:ENSORLT00000025218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLDRYDASRSFRFCMVNFSFPTTLSSDPPPKETASPGPVSPHLTWIKDLLSERPQSVRLG
PPPLTMTLSTGSPQGRVLGPLLFTLYTSDCSSTHQSNAIITLADDTAVSPYRDEVSRLEE
WCSGNNLHLNTTKTKEVILDFRKGRVDPPPLYDPHHPNQHLF
Download sequence
Identical sequences H2N1B8
ENSORLP00000025217 ENSORLP00000025217 8090.ENSORLP00000025217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]