SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000025567 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000025567
Domain Number 1 Region: 33-205
Classification Level Classification E-value
Superfamily eIF4e-like 1.57e-70
Family Translation initiation factor eIF4e 0.0000000365
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000025567   Gene: ENSORLG00000020641   Transcript: ENSORLT00000025568
Sequence length 210
Comment pep:novel ultracontig:MEDAKA1:ultracontig115:5415576:5469902:1 gene:ENSORLG00000020641 transcript:ENSORLT00000025568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSENKVRPRREQSQGSSERKKKSLRGLLEKNKQFKWTLWFFKNDKSKTWQANLRLISTFD
TVEDFWALYNHIQLSSNLMSGCDYSLFKDGIEPMWEDERNRRGGRWLITLSKQQRKMDLD
RFWLETLLCLVGEAFDDHSDDVCGAVINIRAKGDKIAIWTTNCENKEAITQIGRVYKERL
GVPPKVIIGYQSHADTATKSSSTTKNKFVA
Download sequence
Identical sequences H2N291
ENSORLP00000025567 8090.ENSORLP00000025567 ENSORLP00000025567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]