SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000025763 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000025763
Domain Number 1 Region: 5-188
Classification Level Classification E-value
Superfamily DNase I-like 0.000000000273
Family DNase I-like 0.018
Further Details:      
 
Domain Number 2 Region: 368-541
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 0.0000187
Family RNA-dependent RNA-polymerase 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000025763   Gene: ENSORLG00000020803   Transcript: ENSORLT00000025764
Sequence length 672
Comment pep:novel ultracontig:MEDAKA1:ultracontig269:317140:321876:-1 gene:ENSORLG00000020803 transcript:ENSORLT00000025764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVPVIITGNVRSLANKTDELEEYRESSLLCFTETWLHPHPSDHCVVLPGFVTEQADRDAT
ASGKKKGGGIILYVLNPTHVCIKERICCPNVELLPLGLQPYYLPREFTSAIVVSVYIPPS
ADADAAADVIDQYTISWLQEHQPNAFIVITGDFNHVNLDGTLTEFTQYVDGPTRENKILD
LLYCPRWVSVCINSTTDCITEYIKFCENTIMPSRTVCCYPNNKSCITSDLKTLWNEKKRA
FRLGDKGWLKRVRHRLRDKLRECKNSYKGKLEAKLQKNNMRGVWTGMMKITGWHRERAND
LNIFFNRFGSPPRSTPPLPQHLHNPPPLIVQPPSSSSSCCPPDQTETSARILESCTAQLS
TVFQCLFTSLSLMRVSATWKTACLLPVPKKTERLLALMSHAAKVLEKILLAHLRPLVKPS
LDPLQFAYQPRLGVQDAVIYLQYYVITFAHVNAATVRVTFFDFSIEFNTIQPWLMGKKLR
LMGVDRALVSWIIDYLSEWPQFVRMGSILSDMVTSSVGAQQGTVVSPFLLTLYTSDFQYN
SESCHLQKFSEDSAVVGCITGGREEEYREIREVGWRKPPAAQCKTREMVVDFRKKPPASR
PLRILGRDVTEVEGNKYLGVTIDNRLSWKSNNNTAVHKKASSRLYFLRRLRSFNMCSRML
EIVYQSVEVSTL
Download sequence
Identical sequences H2N2S4
ENSORLP00000025763 8090.ENSORLP00000025763 ENSORLP00000025763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]