SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000003364 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000003364
Domain Number 1 Region: 387-704
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.36e-85
Family Protein kinases, catalytic subunit 0.00000174
Further Details:      
 
Domain Number 2 Region: 199-299
Classification Level Classification E-value
Superfamily MAST3 pre-PK domain-like 1.28e-40
Family MAST3 pre-PK domain-like 0.0000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000003364   Gene: ENSORLG00000002700   Transcript: ENSORLT00000003365
Sequence length 731
Comment pep:novel chromosome:MEDAKA1:12:3431423:3466913:-1 gene:ENSORLG00000002700 transcript:ENSORLT00000003365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAQRERLRIPGLTLDLTPRSLSPTPTSPCSPCSPLHAFHFWSCRTSNRKSLIGSGQSSG
LTRPHSPLSSLTAGTSPQDSPRNFSPSASAHFSFARRTDGRRWSLASLPSSGYGTNTPSS
TISSSCSSQEKLHQLPFQPTPDELHFLSKHFCTESISGEECRRATAMRPRSRSLSPGRSP
SCYDHEIIMMNHVYKERFPKATAQMEEKIQEIIRSNSPESVPPLADGVLGFAHHQIIELA
RDCLEKSRFGHITSSYFCELTDKLERLVQESTERSESEEVNFIKELVKKILIVIARPARL
LECLEFDPEEFYHLLEAAEGHAKEGQGIKTDIPRYIISQLGLTRDPLEEIAQLTSCDSGI
AETPETDDSSQSIGTALRSRRKPCELDFEMIKLISNGAYGAVYLVRHKETKQRFAMKKIN
KQNLMLRNQIQQAFVERDILTFAENPFVVSMYCSFETRRHLCMVMEYVEGGDCATLLKNM
GPLPVDMARMYFAETVLALEYLHNYGIVHRDLKPDNLLVTSMGHIKLTDFGLSKVGLMNM
TTNLYEGHIEKDAREFSDKQVCGTPEYIAPEVILRQGYGKPVDWWAMGIILYEFLVGCVP
FFGDTPEELFGQVISDEINWPEGEEAPPLDAQELVTLLLRQNPLERLGTGGAAEVKQHQF
FHHLDWNGLLRQKAEFIPQLESEDDTSYFDTRSERYHHLETEEDDTNDEDFSVDLRQFSS
CSHRFSKVYSS
Download sequence
Identical sequences H2LBT5
ENSORLP00000003364 ENSORLP00000003364 8090.ENSORLP00000003364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]