SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000007427 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000007427
Domain Number 1 Region: 87-182
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-30
Family PDZ domain 0.013
Further Details:      
 
Domain Number 2 Region: 9-64
Classification Level Classification E-value
Superfamily L27 domain 3.73e-26
Family L27 domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000007427   Gene: ENSORLG00000005909   Transcript: ENSORLT00000007428
Sequence length 201
Comment pep:novel chromosome:MEDAKA1:3:16390555:16393641:-1 gene:ENSORLG00000005909 transcript:ENSORLT00000007428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLGEPVRLERDINRAIELLDKLQRTGEVPPQKLQALQRVLQSEFCNAVREVYEHVYET
VDINSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYIS
RIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGTVKLVVRYTPKVLEE
MESRFEKMRSARRRQQNNYPQ
Download sequence
Identical sequences H2LN04
8090.ENSORLP00000007427 ENSORLP00000007427 ENSORLP00000007427 XP_004067089.1.28442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]