SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000012574 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000012574
Domain Number 1 Region: 191-362
Classification Level Classification E-value
Superfamily Fibronectin type III 1.4e-23
Family Fibronectin type III 0.0048
Further Details:      
 
Domain Number 2 Region: 3-183
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000135
Family Fibronectin type III 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000012574   Gene: ENSORLG00000010023   Transcript: ENSORLT00000012575
Sequence length 472
Comment pep:novel chromosome:MEDAKA1:13:19626087:19633578:-1 gene:ENSORLG00000010023 transcript:ENSORLT00000012575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALPPPSVMVKSISNDSMSLSLSLDSKIEVKLFMAVLSWQFDSHVKESRNYNVTSGILKGS
PPSNLTAGTLYEVAVWAHTSTGDSPTTLSQQRTTGTPPKKPLLKAKALNQTAVECSWTVS
GPLAKQYGVFYATSFLDLYRWPRRVDSASFNLTVTVDRDEQYLFLVRAVYPFLGPPSDYA
VVKMIPDERLPPRNLHRVRVDQTQATLKWQPPYDTPSKPLTYVIHVRDVIQNVERDYKFT
SQSNTVEYLLKDLEPGGRYSISVRLLNMSKEASFTLSTTPLPPPEALKILTENDHVFLFW
KSLAVRERGFNESRGYEVHAFDSTTNHTSYLGNTTETFFRITSLLPGHSYTFSVQARCLL
GGQLCGDPAVVLYNTLAEGTSDASRTEVHSQDMAAVVVPVLFVLLLGMCGGLVALYLRHR
RLQNNFTAFANSHYNSRLGSAIFSSGDELGDDDDEDAPMISGFSDDVPMVIA
Download sequence
Identical sequences H2M2D2
ENSORLP00000012574 ENSORLP00000012574 8090.ENSORLP00000012574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]