SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000015168 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000015168
Domain Number 1 Region: 623-697
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000053
Family Anti-sigma factor antagonist SpoIIaa 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000015168   Gene: ENSORLG00000012121   Transcript: ENSORLT00000015169
Sequence length 742
Comment pep:novel chromosome:MEDAKA1:23:9095942:9130977:-1 gene:ENSORLG00000012121 transcript:ENSORLT00000015169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMRPGARQYVVTRPLYSEDSFAEEHEKVYRQRKTMLDHLKLYFTCDVKRVKHAALSLLPV
IGWLRIYRIKEWLLPDVVSGVSTGLVAVLQGMAYCLLASLPPWYGLFSAFFPVVIYFFMG
TSRHISVGPFPVLCLMIGSVVTRLIPDEGPPVNITGLEGLSVDDQRVLVASSVTFLVGIM
QLGMGLLQVGFVVMYLSDTLVSGFTTAAAIHILVSQLKFVLGLLFLFQTLEVIFNKITST
NVCDLVIALIIMAMVFIVKELNDKFKSKLPVPIPIEVIMTVIACGVSYGFDFENKFGIDV
VGHIPQGYESPVAPNLQIFQETAMEAFPMAIVGFAVAFSVAKVYSVKHDYTIDGNQELIA
FGVSNMFGATFKSFAASTALSRSAVQESTGGKTQMFTPLMQELSKNLNTLALVFKTVPAK
QQLLQKRCRLIFISFLLHLLQVIILPYLFSALRPTCMNFLGTIISQDLNGLQVPNAEENG
IVVEIRSLLFFTSLEYMQKYQSLKETDYSRNRLQYPHPPPPTGCFPIDISLKLQNGQDNK
RSELPVSSNITPRNSALQLPNKLLKKKKDLPTTAMGFLNTTCGSIGDSEDQDNMEELDQP
IDFKDLPAQIDWNRDLPANIFVPKVEVHSLILDFAAVSFLDISALKGLKTMLKELIRIDI
EVYIVACDPYILEKLHDCCFFDEEVQPSMFFLTLHDAMLNILDKHSEQTEKNPDHGKIIT
TVTVHNSLKIREKDVPEPEHKF
Download sequence
Identical sequences H2M9I2
8090.ENSORLP00000015168 ENSORLP00000015168 ENSORLP00000015168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]