SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000016640 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000016640
Domain Number 1 Region: 42-242
Classification Level Classification E-value
Superfamily Fibronectin type III 5e-31
Family Fibronectin type III 0.00064
Further Details:      
 
Domain Number 2 Region: 1329-1426
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000307
Family Fibronectin type III 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000016640   Gene: ENSORLG00000013281   Transcript: ENSORLT00000016641
Sequence length 1566
Comment pep:novel chromosome:MEDAKA1:24:6896698:6914473:-1 gene:ENSORLG00000013281 transcript:ENSORLT00000016641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IASESVHVVSLQAQTAQGQRAPPNRAVAVKTTPALCLHVCSPEPPINEARDINVRVMSPK
SVLISWVDPAVEMGKVAPEASRSYTVRFREKGESARWEYQESSQRRVMIETLSADGMYEF
SVRISEGEKHSTWSASVFQRTPESAPSGPPENFEVKPLRGKGTVVTATWDPPEEPNGRIR
EYILSYAPAMKPFGMKSITYSGSTTTATVDGLTPGERYIFKIRATNRKGMGPQSKTFSVA
MPHGASSSSKAKLHSQQTISSGAKSRIQSTEVPPATTPQLHPASRRLRPLSQTRSYHSVF
SALRGSFRHVSNRVKARDDEVEEEDKITPTTPSIEETTTVEIIPETKKIDNNVDPVSDEK
LGYDDEPKPTNPPSLKVLTPSPTKPVHKNAFRPNRRPVKIRVHQKSGSKMISSPSSPKDS
FVATADSASTFSAKSSISSSSLNSSSSLPSLSMSLPSSASSSSSASSSSSHIQNPEANRK
VNVAATYPHSPKIYIKSNRTEAKPSTAILNGANSPKINILTTGRGSLAGRNSSSGFGVRF
GRKHPGLFVKGNSFQISRSYQPAVASHLNLPSRQASNSKSPSKTLSASQEGAENQETQNV
FNPKASQTTLTSITDILATLDTNVFDKPQLTTGTAVRGSTARQGIKPFDSGSIFSAPQGV
SPNSATLNANQILQGSKDSTDQDTTYKQTTYLTTDKNPNEAEVTKLDEPSVGSERETIET
GKREEERGHQSRNGKRVHSRNRLNPSFAERSPWQASQYPGRFNSRSRASLPRKSSRMPIT
HVSSSVGAGKPLLTETQTRLSGAAGSSIQETKEDLRISPGHDTQKNRLGSSLVQSNQNTT
SDTKKALTSVYPSASTKLNSDSLHFLSAKRPSSEHTEKEIIKKKTHNHNGDQLQERSGED
GNDLAESYEDPAITFVSEGNAKNGENADRGEALSRTKPSLFSRVSQSPRRSGVRITGNER
SSHLNTGLFAGSRLPIRPHAAQNSRLDATITRTGGLTGSNSQSSMSSSLLRNSFRNHGSR
RRLPTINRKPNGGNGNVYSLTSLGSSKAASQKSIIGPDGTKWMIDFERGVLMNQDGQVLQ
DSQGKPKRVVLGEDGRTIFDHMGSPLLNQEGLALFGHGRGSQPVVNPKDKVLMVGGKPVL
GLDVFRPRSFSSTTTTTTALPTTAAPTTTEWSSEEFTTALPFPTCPPGTFSKTDEFGYPL
LDQEGILDCYPEVDNLSVFLTIWRIKNSLSSVISDEIFVQTTLVPTTTTRTTTEIPTPEP
NRPINRGPSAAFDLSGKKRFTAPYVNYIRKDPGAPCSLTEALEFLQVDVLEDLMKKDRQA
ASQGEAPKHKPHNLTVVAMEGCHSFIILDWARPLKGDMVSGYMVYSASYDDVIKNKWSSR
LSNGTHLPVENLKPNSRYYFKVQAKNVFGLGPVSETLTYVTESDDPLLIERPPGGEPIWI
PFTFKYNPGHSSCKGSQYVKRTWYRKFVGVVLCNSLRYKIFMGDGLRELFHSIGDTVGQG
EDHCQFVDSYRDGRTGPISVLNNLPSTQGYYRAYRQEPVKFGAIGPRTPHSVVGWYECGV
PIPGKW
Download sequence
Identical sequences H2MDJ5
ENSORLP00000016640 ENSORLP00000016640 8090.ENSORLP00000016640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]