SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000020350 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000020350
Domain Number 1 Region: 88-183
Classification Level Classification E-value
Superfamily PDZ domain-like 7.1e-30
Family PDZ domain 0.013
Further Details:      
 
Domain Number 2 Region: 9-65
Classification Level Classification E-value
Superfamily L27 domain 2.83e-22
Family L27 domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000020350   Gene: ENSORLG00000016254   Transcript: ENSORLT00000020351
Sequence length 218
Comment pep:novel chromosome:MEDAKA1:23:19543053:19572510:1 gene:ENSORLG00000016254 transcript:ENSORLT00000020351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMATVVQPLTLERDVARAIELLEKLQESGDVPGHKLQSLKKVLQSEFCTAIREVYQYMHE
TITVNGCPEYQARATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNVMGGKEQNSPIYI
SRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDTVKLVVRYTPKVLE
EMEARFEKLRTARRRQQQQLLMQQQQQQNLSSQQNHMS
Download sequence
Identical sequences H2MNP4
ENSORLP00000020350 8090.ENSORLP00000020350 ENSORLP00000020350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]