SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000021324 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000021324
Domain Number 1 Region: 142-323
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000614
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 2 Region: 345-500
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000944
Family Fibronectin type III 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000021324   Gene: ENSORLG00000017043   Transcript: ENSORLT00000021325
Sequence length 565
Comment pep:novel chromosome:MEDAKA1:9:29291722:29305688:1 gene:ENSORLG00000017043 transcript:ENSORLT00000021325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSVYQLTSFLYLTVLILLFSGVTVTHKELKLCEEDERVCVSDLRDCGAHPPPSLQQNLNM
SCYYQQSADDTSSISCEWSEELGSHSSDVSLTFSRRNKVISCQGIFNPLAVFSVTARIKN
PLTGTEIWSRPQTVSHPKEKPFPPVVTVLASTHDSLVVSWKSNTYGNCQLRHRPSRTPAW
TQVPDFFSIHSGQNLNFSITGLSPFTEYRCAVACRGDSGIWSDWSSDVRGKTLDKEPSRL
AEVCYRVEETTSREALRLHLVWKAANPQKGEGRVLWYELSVEPGGKTRNITETTALLVVK
EGNYSVSVRGFNTACSGPTTHVQIDTQRRSNPPSVRNLWVISCYPENRTLQVEWEISAAV
SHVIVQLRSDASPSTSRWLRVHGSTTSAGLPDVEADESYQVTVFPVQNQQCGPARSLSAS
LPHGALIEAVGLKVLRVTEAEVTIKWAWQPKSGPIRVSRYMAALRGDPHSRAWRLFPDEN
QHTFVNLTPDTEYTVLLLADSRPVSYVAVKTDLSQGPGAVAIATPLLLAVALLILSVLSR
TVFRSLCFPPVSSPRGSTAGLWLMN
Download sequence
Identical sequences H2MRE5
ENSORLP00000021324 ENSORLP00000021324 8090.ENSORLP00000021324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]