SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000021471 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000021471
Domain Number 1 Region: 88-182
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-30
Family PDZ domain 0.011
Further Details:      
 
Domain Number 2 Region: 9-63
Classification Level Classification E-value
Superfamily L27 domain 3e-22
Family L27 domain 0.0000986
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000021471   Gene: ENSORLG00000017162   Transcript: ENSORLT00000021472
Sequence length 207
Comment pep:known chromosome:MEDAKA1:8:25039494:25044852:1 gene:ENSORLG00000017162 transcript:ENSORLT00000021472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAMAEPLCLERDVCRVIELLDRLQRTGELPPPKLQALQRVLQSKFCAAIREVYEQLYDT
LDIVGGPEVRAQATAKATVAAFAASEGHAHPRVVELPKTDEGLGFNIMGGKEQNSPIYIS
RVIPGGVADRQGGLKRGDQLLSVNGVSVEGEQHEKAVELLKAAQGSVKLVVRYTPKVLEE
MEARFEKMRSARRRQQHTSYSSLESRG
Download sequence
Identical sequences H2MRT8
ENSORLP00000021471 ENSORLP00000021471 8090.ENSORLP00000021471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]