SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000024074 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000024074
Domain Number 1 Region: 107-164
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-24
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 2 Region: 220-276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.18e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 163-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-22
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 4 Region: 275-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.39e-22
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSORLP00000024074
Domain Number - Region: 83-117
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000111
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000024074   Gene: ENSORLG00000019338   Transcript: ENSORLT00000024075
Sequence length 358
Comment pep:novel scaffold:MEDAKA1:scaffold510:97932:100647:-1 gene:ENSORLG00000019338 transcript:ENSORLT00000024075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQEEPERPQTKEEKEEQEPPQIEEEMQVPEPPQMKEEPGEFCISQDEDRLVLKQETDTLM
ELPSYKEDENSEADRNNQQSFNISLFRIHIGVHAQHKRLSCTECEKSFRYVSHLKTHMTT
HTGEKPFSCNECDKNFSHISNLKRHMRTHTGEKPFSCKECDKSFSCIFDLKTHMRTHTGE
KPFSCKECKKSFSQLSTLKTHMRTHTGEKPFSCQECKKYFRNTSHLKAHMRTHTGEKPFS
CTDCDKSFSRISLLKRHMRIHTGEKPFSCKECKKSFNQISHLKRHMRTHTGEKPFSCKEC
NKSFSQLSTLKTHMRTHTGEKPFSCTDKLGRGTSMINEIIYETRAHTHAGRHTHSRTY
Download sequence
Identical sequences H2MYI7
ENSORLP00000024074 ENSORLP00000024074 8090.ENSORLP00000024074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]