SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSORLP00000025376 from Oryzias latipes 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSORLP00000025376
Domain Number 1 Region: 897-1074
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.06e-44
Family BCR-homology GTPase activation domain (BH-domain) 0.00032
Further Details:      
 
Domain Number 2 Region: 477-592
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 5.89e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.00098
Further Details:      
 
Domain Number 3 Region: 116-199,271-366
Classification Level Classification E-value
Superfamily PH domain-like 3.52e-24
Family Pleckstrin-homology domain (PH domain) 0.00027
Further Details:      
 
Domain Number 4 Region: 647-775
Classification Level Classification E-value
Superfamily PH domain-like 7.67e-18
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 5 Region: 1208-1310
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000295
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 6 Region: 9-71
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000471
Family SAM (sterile alpha motif) domain 0.0032
Further Details:      
 
Domain Number 7 Region: 378-491
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000141
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Domain Number 8 Region: 786-900
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000103
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Domain Number 9 Region: 1113-1178
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000482
Family Ras-binding domain, RBD 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSORLP00000025376   Gene: ENSORLG00000020481   Transcript: ENSORLT00000025377
Sequence length 1411
Comment pep:novel ultracontig:MEDAKA1:ultracontig115:3755941:3776807:-1 gene:ENSORLG00000020481 transcript:ENSORLT00000025377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLDGSTPVETLLAAIHLERYLDSFKRASLLLARDFTHLDHDALISLGVTATGHRKRIL
RLVHLIQRQKTDNPRGRCQSMTESDDPDTSRQPVKPVPKPRTVFNRSRTVPVNFCPSPDP
APPPDKRQSQESICLTVLEDVSSDTPTAENSQASEATPNHNSLDSSRLSGSPPSGSPRGP
GVEMVSNEIYWGSSPVSTAPNGRHSVGFSNDQPEVRCLFRNDTLTASETGYSTVGEAPLP
PSCLSLPASTFADADEDLTISPYASYTSLSERAPPILTGWLDKLSPQGNYVFQKRFVKFD
GKNLMYFGSEKDIYPRGVIPLAVIQMARLAKDNKFEIVTSNRIFVFRTDNEVLRRRWVTT
LQEHIRDQLVFGRRRFGPGSHCQKHGVLELKGTKSKVYTAISTDQIWLHKSEQCFRNGIG
ITVIEARGATIRDGKHRSFDLITPYKSFSFTAESERDKRDWMEALQEAIAETLSDYEVAE
KIWSNRSNRMCADCKAVNPDWASINLCVVICKNCAGQHRSLGSMVSKVQSLKLDTSVWSN
EIVQLFIMVGNDRANDFWAAHLSQSEELDCDASPEQRKDFITQKYKEGRFRLAHPAFSTH
EELLKALCTALSEQTLLKTVTQIFLEAESARLTGDSRRQHDAPQGYSPSTGLLCVSDPGV
YDEIMQSVLHSGFLYKCSSVSRGTISRKNREDFQKFWCVVDQYLLLYESEQSSEPSLQIN
LKDMVCLGVCRPDSSMSSRFRYTFELYLTSEKLYQFGLETAESLHSWTKAIGKAATPLSC
HCLLTREFERVGLLRYRAMLDPQQWKDAYFVLQKSNLFICPRNDGAAEDIINLKRLQELS
VASENDNQEKKDILVLVEKGRTLHLHAIGRMDFSLWYSDIQRAAGGRGNTLREQQMSRND
IPIIVDSCIAFITQYGLGHEGIYRKNGAKTRIRLLMEEFRKDARNVKLRIGDHFIEDVTD
VLKRFFREIDDPIFMAELHAFWQEAAKIPQKRQRLERYKEIIRSLPRVNQTTLAALIGHL
YRVQKCADLNQMCTKNLSLLFAPSLFQTDGKGEHEVKIVEDLIDNYLFVFDIDEEHQTQI
ELEISLITTWKDTQLSQAGDLIIEVYLEMKVTDCCITLKVSPTMCAEELTNQVLYMRNVP
AGERDVWMTFEAIEDGQLERPLHPKEKVLEQALQWCKMANPSSAYLVVKRVPQGEGIQLL
TSYKSETMKIGLLRCREEPPKLLQGTRFQERTFQIRNHKLLLLKDRKSIKPEKEWFLKSM
KIYIGIRKKLKAPTRWGFTVMSDKHQLFLCCSSEAELWDWVTSFLKAQNDDPGLPVMRRH
SLSEISKQKFGTMPLVPIRGVETNSSMLSANQTLRKLHDRRTLSMYFPMKVQRDSFEERS
ESPDLPEPLYEEVGDFGLQVLRSLETSFLTS
Download sequence
Identical sequences H2N1R3
ENSORLP00000025376 ENSORLP00000025376 8090.ENSORLP00000025376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]