SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000006484 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000006484
Domain Number 1 Region: 245-356
Classification Level Classification E-value
Superfamily Immunoglobulin 7.4e-21
Family V set domains (antibody variable domain-like) 0.00018
Further Details:      
 
Domain Number 2 Region: 33-144
Classification Level Classification E-value
Superfamily Immunoglobulin 2.7e-20
Family V set domains (antibody variable domain-like) 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000006484   Gene: ENSOANG00000004084   Transcript: ENSOANT00000006486
Sequence length 357
Comment pep:novel supercontig:OANA5:Contig27347:234:13235:-1 gene:ENSOANG00000004084 transcript:ENSOANT00000006486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKMVGFPEYFTARHFIILLLFLQLPTLCSARFSVVGPAGPVLARLGGVAVLPCHLVSKE
SAEKMEVRWFRTQPSNIVHQFKDQKDVFGEQMKEYQGRTEMVKHAIDKGNVALRIRNIGL
SDEGKYHCSFSGDTEQGETTMELQLVVMGKSWGKHNNGKCEEKRENFTVPGGWILGTGVI
WKFFLGTLWPFLTEDQIHLTIHPFLVVLRETVETFCFVLNNYHYDAPPSSVIVPEPLRDE
VREFSVIGPAEPILALEGKDVELPCHLKPKMNAESMEVRWFRSQPSDIVHLYENRKDRFQ
QQMEEYHKRTKLVTDAMDYGSVAVRVYNVTVSDEGQFRCSFYNGQVSEVATLELQVV
Download sequence
Identical sequences F6S7K9
ENSOANP00000006484 ENSOANP00000006484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]