SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000006923 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000006923
Domain Number 1 Region: 49-132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000157
Family V set domains (antibody variable domain-like) 0.031
Further Details:      
 
Domain Number 2 Region: 253-327
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000136
Family I set domains 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000006923   Gene: ENSOANG00000004369   Transcript: ENSOANT00000006925
Sequence length 343
Comment pep:novel supercontig:OANA5:Contig30202:1969:4969:-1 gene:ENSOANG00000004369 transcript:ENSOANT00000006925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGMGPFLAALFLGLGLRAFEIVEKENIFEQTPCPAFLLFDNTAFLADMSFELPCHCKPEE
VSAVVWYYQARPGSLHTKVLTDFDGRVATDARLVRAGSDVLTRFSIRLFSLVVFRAQPGD
SGLYLCGTRRGDYFYGYDVDVQSSRGLAVAFSERGQRPRGDEVRGPLRLFTTFWEWTRCD
RCGVPGEQWRLGLCYLQGSGLSARYRKSLPDVVSCGSRAVPRELRELVIRRCRAPCPTKP
PRRSRPGLSDVVPVQFHRQRLGHGLILTCPGARPEHAVAWDKGGLRLYLARYLVGVNRSM
RVFIDHGHQLHIRFARLDDRGLYRCWWPSGLHGGGERLGLGSR
Download sequence
Identical sequences F6PGG0
ENSOANP00000006923 ENSOANP00000006923 9258.ENSOANP00000006923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]