SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000008782 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000008782
Domain Number 1 Region: 145-438
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 3.79e-98
Family Cryptochrome/photolyase FAD-binding domain 0.0000151
Further Details:      
 
Domain Number 2 Region: 2-163
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 3.53e-32
Family Cryptochrome/photolyase, N-terminal domain 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000008782   Gene: ENSOANG00000005530   Transcript: ENSOANT00000008784
Sequence length 551
Comment pep:novel ultracontig:OANA5:Ultra443:4878777:4891874:-1 gene:ENSOANG00000005530 transcript:ENSOANT00000008784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNIAKLSIEYDSEPFGKERDA
AIKKLASEAGVEVIVRISHTLYELDKIIELNGGQPPLTYKRFQTLISRMDPLAMPVETIT
AEVMGKCMTPLSDDHDEKYGVPSLEELGFDTDGLPSAVWPGGETEALTRLERHLERKAWV
ANFERPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLL
WREFFYTAATSNPRFDKMEGNPICVQIPWDRNPEALAKWAEGRTGFPWIDAIMTQLRQEG
WIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSVNAGSWMWLSCSSFFQQFFH
CYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKAAKCIIGVNYPKPMV
NHAEASRLNIERMKQIYQQLSRYRGLGLLASVPSNPNANGSGGLMAYSPGENIPGCSSGG
VWALSSGGTKKTKPQTGYCQGSGVLYYANGESHLRKAGRSSLTPGLSGGKRPCQEEESQS
IGPKVQRQSTD
Download sequence
Identical sequences F6X5C4
ENSOANP00000008782 ENSOANP00000008782 9258.ENSOANP00000008782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]