SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000009094 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000009094
Domain Number 1 Region: 536-670
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.97e-30
Family cAMP-binding domain 0.0014
Further Details:      
 
Domain Number 2 Region: 291-408
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000000267
Family Voltage-gated potassium channels 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000009094   Gene: ENSOANG00000005713   Transcript: ENSOANT00000009096
Sequence length 1018
Comment pep:novel supercontig:OANA5:Contig7479:20844:42946:-1 gene:ENSOANG00000005713 transcript:ENSOANT00000009096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSCFLCLVDVVPVKNEDGVVIMFILNFEVVMGTELVGSPARDTNHRGPPSGWLPPGKTLV
VTGFPPTNSPSPPPALTPGCCLGAGAKAVPGLETLRPHLLVLPHPHSPDSTSLLPRPPPA
FLRPALSLSPSRCWALILPPLGQLVNPRTGRPPDPDSSLRTGAQPSCATLSPFHSPAVSV
ASDAPIHPAPPGPPGAMHPLRSSLLNSTSDSDLVRYRTISKIPQITLNFVDLKGDPFLAS
PTSDREIIAPKIKERTHNVTEKVTQVLSLGADVLPEYKLQAPRIHRWTILHYSPFKAVWD
WLILLLVIYTAVFTPYSAAFLLKESEEGVSPPPDCGYACQPLTVVDLIVDIMFIVDILIN
FRTTYVNANEEVVSHPGRIAVHYFKGWFLIDMVAAIPFDLLIFGSGSEEVRETRLVIHAI
SVQERGCPALLLRSPPLVDTSPRPRGIDLRRGGGAHQSMDQEVRCLHGSTHGIYGMAMEP
VVVGSREWRLGGLAPFRWESPPPNPAACLFLPVLTALMYASIFGNVSAIIQRLYSGTARY
HTQMLRVREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLN
RSLLQHCKPFRGATKGCLRALAMKFKTTHAPPGDTLVHAGDLLTALYFISRGSIEILRGD
VVVAILGTGSGGTAASPHGVEGGPGCTNGLGEYITKQTHSLPTTSLRAAPTTGAWPDRRR
AQRGCPMGIWEPGMRESELIPAATGSCKVTAGEEREWARAQLFPEPLHPDTDPPGEVSSM
GPGGRAANGGPWGESPSSGPSSPLSSDEDEERGPGSSPLRLVPFPSSRPPGGLLSREPVT
DEGEKGSDTCNPLSGAFSGVTNIFSFWGESRGRQYQERLLNIPLPSPTRRPRSEIEGRLD
TLQRQLNRLETRLSTDMAAILQLLHRQMSLVPPAYSTVSVTGEEGPGLTLPTLPTTHTHT
LSLSDTALPVSQFLGCEELPAGTPEPPQDGPARRLSLPGQLGILTSQPLYRHGSDPGS
Download sequence
Identical sequences F7BXY6
ENSOANP00000009094 ENSOANP00000009094 9258.ENSOANP00000009094

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]