SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000010708 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000010708
Domain Number 1 Region: 2-82
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000157
Family I set domains 0.0075
Further Details:      
 
Domain Number 2 Region: 166-257
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000282
Family I set domains 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000010708   Gene: ENSOANG00000006707   Transcript: ENSOANT00000010710
Sequence length 257
Comment pep:novel supercontig:OANA5:Contig13697:6366:16090:-1 gene:ENSOANG00000006707 transcript:ENSOANT00000010710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DKAVFRARVTGSPKPTVTWKRESGLPIKESAKIFYDSINKEYVLKLEPLASDDSDNYKCI
AANSHADAIYTMSLLVTESESEARGPSGQEKMDFKKMLKKRAPPAPKKPQKVTDEKEMLK
ILSKVQKKDFEKVCLEYGFTDFRGLLKKLKEMKKKVEVEFRGAIRILKPLEDLEVKVDST
AVFDCILELKDPNIKMTWCKRINRVMKIYTVERTSTVKYDLKQMGTKYMLYITNVNMNDI
GTYSLSVGDKKMSAQLT
Download sequence
Identical sequences F6QZ46
9258.ENSOANP00000010708 ENSOANP00000010708 ENSOANP00000010708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]