SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000013421 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000013421
Domain Number 1 Region: 9-100
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000289
Family V set domains (antibody variable domain-like) 0.019
Further Details:      
 
Domain Number 2 Region: 219-315
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000192
Family V set domains (antibody variable domain-like) 0.089
Further Details:      
 
Weak hits

Sequence:  ENSOANP00000013421
Domain Number - Region: 117-190
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0146
Family C1 set domains (antibody constant domain-like) 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000013421   Gene: ENSOANG00000008441   Transcript: ENSOANT00000013424
Sequence length 329
Comment pep:novel supercontig:OANA5:Contig5899:27727:33106:1 gene:ENSOANG00000008441 transcript:ENSOANT00000013424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVSTGTGAPRELNGTIGGMVTFPLDIPAGRRVTNIDWRAKQTIAKVSPGEAGNLPKLNFV
LPQYKERLSVSTDYSLTISNLRPEDAGTYRVRINTVNATSNSFTNMEFSLRVYGQLVEPL
VTVKSLAADNSHCTVILTCSMDREGDDVTFSWTPRGRGPPCPLKSPSSASPPSYTCMATN
HNSNSFSSIPGLLCASHCTKHWVSAGTGASLELNGVVMGSVTFPLDIPAGRWVESIIWTS
NGAIATVIPGGPGDPPNIIATTQRHSERLSVSTDYSLTISRLRLEDAGHYRADVSTADTT
GTTTITSQFSLRVYDPERGAFLWAGDMFL
Download sequence
Identical sequences F6QFD3
9258.ENSOANP00000013421 ENSOANP00000013421 ENSOANP00000013421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]