SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000016169 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000016169
Domain Number 1 Region: 402-545
Classification Level Classification E-value
Superfamily PH domain-like 1.08e-39
Family Third domain of FERM 0.0000119
Further Details:      
 
Domain Number 2 Region: 298-403
Classification Level Classification E-value
Superfamily Second domain of FERM 1.7e-36
Family Second domain of FERM 0.00000333
Further Details:      
 
Domain Number 3 Region: 218-297
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.1e-20
Family First domain of FERM 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000016169   Gene: ENSOANG00000010197   Transcript: ENSOANT00000016172
Sequence length 1008
Comment pep:novel ultracontig:OANA5:Ultra520:93447:215755:-1 gene:ENSOANG00000010197 transcript:ENSOANT00000016172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEVGSDTEVKKESEQVDSDSTKEKPEEASEREQNQSSEQEDEEETGSSSPTAAASPKS
PRSQKKKEPSESRGFSRFLPPWLKKQKSYNLVEAKNGGEKQTPEQAGEEEQKQGDREDVL
PEEERPAKGDSEETADRKQQDAKVEDKDEKRSVSSAETQIVDMSDSVTVSQLKNPKESQS
HRDSFSSESKRSTKEVQTTDLKAEKVSQKAAKKIKTVQCKVMLLDGTEYSCALEKRAKGQ
VLFDKVCEQLNLLEKDYFGLLFQENTEQKRWTDKNNGTKQRQGHLPWLFTFNVKFYPPDP
SQLTEDITRYFLCLQLRQDIASGRLPCSFVTHALLGSYTLQAELGDYDPEEHSSDYISEF
QFAPGQTKEMEEKVVELHKTHRGLTPAQADTQFLENAKRLSMYGVDLHHAKDSEAVDIKL
GVCANGLLIYKDRLRINRFAWPKILKISYKRSNFYIKVRPAELEQFESTIGFKLPNHRAA
KRLWKVCVEHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQASTLIDRPAPYFER
TSSKRISRSLDGVTAPVGVMDQSLLRDFSGPTGEISVYGPGAASHVTLQDGEARREVRTP
TKMPHLQLPTEGKSNSLRVYGENIYVRHSNLMLEDLDKAQDDILKHQASISELKRNFMES
TPEPRPNEWEKRRITPLSLQSQGSSHETLIVVEEKQQLEVGQEQRGITEEMNGEGKIPPS
KEPKEARQGEPLIQKDSTSLSSESSSSSSESEEEDVGEYRPHPRVTEGTIREEQEENEED
FKEKEDQTAKVVQSLEAVREVNSVNQTVVHTVPTETVTQENLVSPVIPGEMRLTDGVKQD
TREDTEEEQHKVNGDVSHVDIDVVPQIICCSEPPVVKTEMVTISDASQRTEISTKEVPIV
QTETKTITYESPQIDGGSGGDSGVLLTAQTITSESISTTTTTHITKTVKGGVSETRIEKR
IVITGDTDIDHDQALAQAIKEAKEQHPDMSVTRVVVHKETEVTEEGEE
Download sequence
Identical sequences F6SK30
ENSOANP00000016169 ENSOANP00000016169 9258.ENSOANP00000016169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]