SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000028608 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000028608
Domain Number 1 Region: 159-241
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.1e-18
Family Eukaryotic proteases 0.0049
Further Details:      
 
Domain Number 2 Region: 42-88
Classification Level Classification E-value
Superfamily SRCR-like 0.000000536
Family Scavenger receptor cysteine-rich (SRCR) domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000028608   Gene: ENSOANG00000022418   Transcript: ENSOANT00000032404
Sequence length 241
Comment pep:novel supercontig:OANA5:Contig58329:102:3216:1 gene:ENSOANG00000022418 transcript:ENSOANT00000032404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YVGPPSPPLSLQRDTPQDADKIESCEGSNSEEAPRSGAPKTVSFRINKSNFLLEVQIKGT
AGWLLACHAGWSALLGTRICRALGHISLDHPELLVVGDQLIRPPRRIPNLGDFPGLYIPG
SWEEKFNTPSALGVALECGGPRTVPPGRLALGRQVCFLGSRQQCGGTVHPRWVVTAAHCV
DSDRLTHGPGWRVIAGLVTRALIKLHTGAVVEEITLHPQYSIRSHDYDIALLRLQTPLNF
S
Download sequence
Identical sequences F7B1X2
ENSOANP00000028608 9258.ENSOANP00000028608 ENSOANP00000028608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]