SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOANP00000029868 from Ornithorhynchus anatinus 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOANP00000029868
Domain Number 1 Region: 78-172
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-29
Family PDZ domain 0.0099
Further Details:      
 
Domain Number 2 Region: 3-55
Classification Level Classification E-value
Superfamily L27 domain 2.24e-19
Family L27 domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOANP00000029868   Gene: ENSOANG00000028575   Transcript: ENSOANT00000039112
Sequence length 208
Comment pep:novel ultracontig:OANA5:Ultra119:510233:566810:-1 gene:ENSOANG00000028575 transcript:ENSOANT00000039112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IHSDVARAIELLEKLQASGEVPVHKLESLKKVLQSEFCTAIREVYQYMHETIAVNGCPEF
HARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVAE
RHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKESVKLVVRYTPKVLEEMEARFEKLR
TARRRQQQQLLIQQQQQQQQQTQQNHMS
Download sequence
Identical sequences K7E8L1
9258.ENSOANP00000007690 ENSOANP00000029868 ENSOANP00000029868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]