SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000006960 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000006960
Domain Number 1 Region: 41-173
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.34e-35
Family Methylmalonyl-CoA epimerase 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000006960   Gene: ENSOCUG00000008055   Transcript: ENSOCUT00000008052
Sequence length 174
Comment pep:novel chromosome:oryCun2:17:83248324:83265598:1 gene:ENSOCUG00000008055 transcript:ENSOCUT00000008052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLPSQLLNKIGYFFPRLQALIPIVRAISTSQCSREVADPVWKLGRLNHVAIAVPDLEKAT
AFYKNILGAQVSEPVPLPEHGVSVVFVNLGNTKMELLHPLGSDSPIAGFLQKNKAGGMHH
VCIEVDNINEAVVDLKKKKVRSLSEEAKIGAHGKPVIFLHPKDCGGVLVELEQA
Download sequence
Identical sequences G1SUD1
9986.ENSOCUP00000006960 ENSOCUP00000006960 ENSOCUP00000006960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]