SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000008563 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000008563
Domain Number 1 Region: 884-1018
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.07e-19
Family cAMP-binding domain 0.02
Further Details:      
 
Domain Number 2 Region: 635-749
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000173
Family Voltage-gated potassium channels 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000008563   Gene: ENSOCUG00000009937   Transcript: ENSOCUT00000009943
Sequence length 1172
Comment pep:novel chromosome:oryCun2:14:106967765:107056877:1 gene:ENSOCUG00000009937 transcript:ENSOCUT00000009943 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTDNAISFNSNPNNRRNTGSWLELFRVLFLNNAEDLPEIILILSLICTIGAFLNLHLKD
FPIPLPVILFLLGCSFEILSFTSFQIQSYADAIQWMSPDLFFGIFTPVIIFNVAFDMDVY
MLQKLLWQILLITIPGFAINYILILWYLQTVNKLFLKTIPWFLFATILVSSDPMLTAAAI
RDLGLSRGLTNLINGESLMTSVISLIIFNSVVNTNFRRQHKTNSTLGSQVMYGIWSYFIA
SFLFGILSSKLIQLWMSTVFGDDVNYISLIFSLLYLIFYICELVGMSGIFTLTIMGLFLN
STSFKPGVEVLLLEFWNCLSFVAFLMVFSFTGLLIPAHTYLYISFSDIYYSINIYFTLIV
LRLLVFLLMSPLLSRLGHGFSWRWAFIMVWSEMKGMPNINMALLLAYSDLSLGSEREKYQ
VLFHGVLVCLITLIVNRFILPMAVNKLGLRDVTSTKYKSVYYTFQHFQELTKSTASALKF
DRDLANADWNVVEKAIVLRNPYALEHEEETLEHQKVRCPSCDKEIDETLNLEAMELANRR
LLSAQIASYQRQYRNEILSQSAVQVLVGAAGSFGEKKGEYMNLGTIKVYSESKKFLTFLR
KLLLNWVYNTKKDKGVPSRHLLFRVCHKAVFTDEFEYVGYLVILMNVFPIIISWIPQLNK
IYDDEIKYTNYSFLAIYILEALLKIAAMRRAYFSHAWNIFELAITFIGIIDVILIETSAI
NYSFDLIQTVVIMKIARFLRLLRILKLVTPKLLQIIDQKMSHQLSFRYAILKGYVQGEMD
VMTIIDQIASSKQVKQMLLKRVIRNMELSMKELGYLEYDHPEIAVTMKSKEQINVMLNMA
REIVKVFRSKGIIHKIECAEINKLIMAKTREVLDFQSIIKPMTVEETLYHIPWLDKDENF
INFIQERAKIVTFDCGNNIFEEGDEPKGIYIIISGMVKLKRSKPGLGIDQMESEDKDYQI
IYTDYVLSGEIIGELNCLTNEQMKYSAICKTVVETCFISKTHLIEAFEQCCPIIEHKMWL
KIGLGITARKIREHLSYEDWNYKMQLKLCNIYVRDIPKSIKSDIYDETVTDVILKHAIRC
EICQCRKSMRDGYLMQQIQGTEDFTKVMMIQTSIDMKKFRFNSRKYVSTRKISSVPKSLA
AAKRMLEGCLQEEANKGEIQESEELLEENINI
Download sequence
Identical sequences ENSOCUP00000008563 9986.ENSOCUP00000008563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]