SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000010879 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000010879
Domain Number 1 Region: 538-570,651-725
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.63e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000010879   Gene: ENSOCUG00000012634   Transcript: ENSOCUT00000012637
Sequence length 780
Comment pep:novel chromosome:oryCun2:7:44146456:44204867:1 gene:ENSOCUG00000012634 transcript:ENSOCUT00000012637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPGNRSEPPQQLPEYNCSYVVSRPVYSELAFQQKHERRLQERKTLRESLAKSCSCSRK
RAFGVLKALLPILEWLPKYRVKEWLLSDIISGVSTGLVGTLQGMAYALLAAVPLGYGLYS
AFFPILTYFIFGTSRHISVGPFPVVSLMVGSVVLNMAPDEHFLIPGNGTTSNTTVVDSVA
RDAERVLVASALSLLVGIIQLILGGLQIGFIVRYLADPLVGGFTTAAAFQVLVSQVKIVL
NVSTKNYNGVLSIIYTLIEIFQNIRDTNIADLIAGLLTIVICMAVKEINDRFKHKIPVPI
PIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFLPPSLPPVSLFSKMLAESFSIAVVA
YAIAVSVGKVYATKYDYTIDGNQEFIAFGISNIFSGCFSCFVATTALSRTAVQESTGGKT
QVAGIISAGIVMIAIVALGKLLEPLQKSVLAAVVIANLKGMFMQVCDVPRLWRQNKVDAV
IWVFTCVVSIILGLDLGLLAGLVFALFTVVLRVQFPSWNSLGSIPSTDIYKSTKDYKNIE
EPEGVKILRYSSPIFYANVDGFKKCIKSTVGFDAIRVYNKRLKALRRIQKLIKKGQLRAT
KNGIISDAGSPNAAFETDEDIEDLEELDVPTKEIEIQVDWNSELPVKVNVPKVPIHSLVL
DCGAISFLDVVGVRSLRVIVKEFQRINVNVYFASLQDHVMEKLEHCGFFDDHHRKDTFFL
TVHDAILYLQNQVKSTKGEDSILETINLIQDCKDPLELMDAELAEEELDVQDEAMRRLAS
Download sequence
Identical sequences G1T3S0
ENSOCUP00000010879 9986.ENSOCUP00000010879 ENSOCUP00000010879 XP_002712085.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]