SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000015751 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000015751
Domain Number 1 Region: 626-761,818-884
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.49e-39
Family Hemopexin-like domain 0.00077
Further Details:      
 
Domain Number 2 Region: 69-108
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000235
Family Somatomedin B domain 0.0012
Further Details:      
 
Domain Number 3 Region: 27-66
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000085
Family Somatomedin B domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000015751   Gene: ENSOCUG00000027187   Transcript: ENSOCUT00000032029
Sequence length 884
Comment pep:novel chromosome:oryCun2:16:84071666:84086400:-1 gene:ENSOCUG00000027187 transcript:ENSOCUT00000032029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEWKVLPVYLLLLLSVVLVDQVSSQDLPSCAGRCGEGYSRDATCNCDYNCQHYMECCPDF
KKVCTVELSCKGRCFESFARGRECDCDAQCKKYGKCCSDYEKFCEEVHNPTSPPSSKPAP
PPPGASQTIKSTTKRSPKSPNKKKTKKVIESEEITEEHSVSENQATIRKIKSSKNSAANR
ELQKKPKVKDNKKKRTPKKEPAPKPPATDEAGSGLDSAPAPDIPTTPRSKVTTSPKTTTV
KPTNPKPSLPPKPKEKPSTSNKETTVKTKETTETNKQTSTSAKEKTASVKETRTAXPINP
KEPVPTTPKVAAPTNPKKPAPTTPKEPVPTTPLTPAPTTTMGAPTTKTPAESTPESSTGP
TPKVLENSPKQPAVPTTKTPGVIQSEMITTAKDKNTEKDIHTTPEMTTAATKTEDKTPEA
KITSTIRQVTSATTQDTTSFKVTTPKATTLAPKVTTSTKKTTTTEESANKSEVVTPAPKD
TATGAKATPSPPKPTKPSKKPTSTKKPTKVPKKPTSTKKPNTPKVKKPKTTPPLPKTTTP
TLSELNPASVAEAMLQATRSPTPTRDTETVEAHPKNEGAEEQEKPYVIPRPPGFIPILVP
GTEYIVRGPSDGIITNPMLSVLDETNLCNGKPVDGLTTLRNGTLVAFRGHYFWMLNPFSP
PSPPRRITDVWGIPSPIDTVFTRCNCEGKTFFFKDSQYWRFTNDIKDAGYPKQIVKGFGG
LTGKIVAALSIAKYKNRPESVYFFKRGGSIQQYTYKQEPVRKCTRRTPINYSVYGETAQI
RRRRFERALGPQTHTIRIHYSPVRVAYQDKGFLHNEVKVSTIWRGLPSVVTSAISLPNIR
KPDGYDYYAFSKDQYYNIDVPTRTARAITTRSGQTLSKIWYNCP
Download sequence
Identical sequences G1TFQ7
ENSOCUP00000015751 ENSOCUP00000015751 9986.ENSOCUP00000015751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]