SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000023225 from Oryctolagus cuniculus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000023225
Domain Number 1 Region: 644-780
Classification Level Classification E-value
Superfamily EF-hand 0.00000000162
Family Calmodulin-like 0.034
Further Details:      
 
Domain Number 2 Region: 474-527,564-688
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000863
Family Voltage-gated potassium channels 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000023225   Gene: ENSOCUG00000002396   Transcript: ENSOCUT00000022498
Sequence length 970
Comment pep:known chromosome:oryCun2:15:62079802:62134628:-1 gene:ENSOCUG00000002396 transcript:ENSOCUT00000022498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNSSRVQPQQPGDAKRPPAPRAQGPGRLAAGVTAAGAGLAAPGGLREQRGLEIEMERIR
QAAARDPPAGASASPSPPLSSCSRQAWSRDNPGFEAEEDEDEEEVEGEEGGMVVEMDVEW
RPGSRRSAASSAVSSAGARGRGLGGYHGAGHPSGRRRRREDQGPPCPSPAGGGDPLHRHL
ALDGQPPRVAWAERLVRGLRGLWGTRLMEESSTNREKYLKSVLRELVTYLLFLIVLCILT
YGMMSSNVYYYTRIMSQLFLDTPISKSEKTNFKTLASMEDFWKFTEGSLLDGLYWKIQPD
NATEADNRSFIFYENLLLGVPRIRQLKVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPF
GPRNGTAWTYTSEKDLNGSSHWGMIATYSGAGYYLDLSRTREETAAQLAGLKKNVWLDRG
TRATFIDFSVYNANINLFCVVRLLVEFPATGGVVPSWQFQPVKLIRYVSTFDFFLAACEI
IFCFFILYYVVEEILEIRIHKLHYFRSFWNCLDVVIIVLSVVAIGINIHRTSNVEALLQF
LEDQNTFPNFEHLAYWEIQFNNIAAVVVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLF
GFAIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGP
LYFTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQKAEMELSDLIRKGYHKALVKLKLK
KNTVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQM
RDDLEKEREDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEE
FQVLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRES
DVHREQMERLVREELERWESDDAASQLSHGLGTPVGLNGQPRPRTSRPSSSQSTEGVEGG
GGNGSSNVHV
Download sequence
Identical sequences G1SHG5
ENSOCUP00000023225 ENSOCUP00000002070 XP_002717056.1.1745 9986.ENSOCUP00000002070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]